PPP1CC Protein, Human (His)

PPP1CC protein is a multifunctional phosphatase that forms a specific holoenzyme with more than 200 regulatory proteins to dephosphorylate various biological targets. PPP1CC is critical for cell division and regulates glycogen metabolism, muscle contractility, and protein synthesis. PPP1CC Protein, Human (His) is the recombinant human-derived PPP1CC protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.

PPP1CC protein, a versatile phosphatase, forms highly specific holoenzymes by associating with over 200 regulatory proteins, collectively orchestrating the dephosphorylation of numerous biological targets. Essential for cell division, PPP1CC contributes to the regulation of glycogen metabolism, muscle contractility, and protein synthesis. Among its diverse functions, PPP1CC dephosphorylates RPS6KB1, participates in the regulation of ionic conductances and long-term synaptic plasticity, and may play a crucial role in dephosphorylating substrates like the postsynaptic density-associated Ca(2+)/calmodulin-dependent protein kinase II. As a component of the PTW/PP1 phosphatase complex, PPP1CC is integral in controlling chromatin structure and cell cycle progression during the transition from mitosis into interphase. Collaborating with CSNK1D and CSNK1E, PPP1CC determines circadian period length by regulating the speed and rhythmicity of PER1 and PER2 phosphorylation. Moreover, PPP1CC exhibits the capability to dephosphorylate CSNK1D and CSNK1E. Notably, PPP1CC targets FOXP3 in regulatory T-cells from rheumatoid arthritis patients, dephosphorylating the 'Ser-418' residue and rendering FOXP3 functionally defective, thereby contributing to Treg cell dysfunction. The myriad roles of PPP1CC underscore its central position in the intricate network of cellular signaling and regulatory processes.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

N-6*His;C-6*His

P36873-1 (M1-K323)

5501  [NCBI]

MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKK

30-40 kDa

Greater than 85% as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 1 mM DTT, pH 8.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.