1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. PPP1CC Protein, Human (His)

PPP1CC protein is a multifunctional phosphatase that forms a specific holoenzyme with more than 200 regulatory proteins to dephosphorylate various biological targets. PPP1CC is critical for cell division and regulates glycogen metabolism, muscle contractility, and protein synthesis. PPP1CC Protein, Human (His) is the recombinant human-derived PPP1CC protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PPP1CC protein is a multifunctional phosphatase that forms a specific holoenzyme with more than 200 regulatory proteins to dephosphorylate various biological targets. PPP1CC is critical for cell division and regulates glycogen metabolism, muscle contractility, and protein synthesis. PPP1CC Protein, Human (His) is the recombinant human-derived PPP1CC protein, expressed by E. coli , with N-6*His, C-6*His labeled tag.

Background

PPP1CC protein, a versatile phosphatase, forms highly specific holoenzymes by associating with over 200 regulatory proteins, collectively orchestrating the dephosphorylation of numerous biological targets. Essential for cell division, PPP1CC contributes to the regulation of glycogen metabolism, muscle contractility, and protein synthesis. Among its diverse functions, PPP1CC dephosphorylates RPS6KB1, participates in the regulation of ionic conductances and long-term synaptic plasticity, and may play a crucial role in dephosphorylating substrates like the postsynaptic density-associated Ca(2+)/calmodulin-dependent protein kinase II. As a component of the PTW/PP1 phosphatase complex, PPP1CC is integral in controlling chromatin structure and cell cycle progression during the transition from mitosis into interphase. Collaborating with CSNK1D and CSNK1E, PPP1CC determines circadian period length by regulating the speed and rhythmicity of PER1 and PER2 phosphorylation. Moreover, PPP1CC exhibits the capability to dephosphorylate CSNK1D and CSNK1E. Notably, PPP1CC targets FOXP3 in regulatory T-cells from rheumatoid arthritis patients, dephosphorylating the 'Ser-418' residue and rendering FOXP3 functionally defective, thereby contributing to Treg cell dysfunction. The myriad roles of PPP1CC underscore its central position in the intricate network of cellular signaling and regulatory processes.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

N-6*His;C-6*His

Accession

P36873-1 (M1-K323)

Gene ID
Molecular Construction
N-term
6*His
PPP1CC (M1-K323)
Accession # P36873-1
6*His
C-term
Synonyms
Serine/Threonine-Protein Phosphatase PP1-Gamma Catalytic Subunit; PP-1G; Protein Phosphatase 1C Catalytic Subunit; PPP1CC
AA Sequence

MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKK

Molecular Weight

30-40 kDa

Purity

Greater than 85% as determined by reducing SDS-PAGE.

Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 1 mM DTT, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

PPP1CC Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PPP1CC Protein, Human (His)
Cat. No.:
HY-P71228
Quantity:
MCE Japan Authorized Agent: