PPY Protein, Human (HEK293, His)

PPY, a pancreatic hormone, regulates pancreatic and gastrointestinal functions. Its action may involve signaling through the G protein-coupled receptor NPY4R2, coordinating processes for homeostasis in both systems. PPY Protein, Human (HEK293, His) is the recombinant human-derived PPY protein, expressed by HEK293 , with C-6*His labeled tag. The total length of PPY Protein, Human (HEK293, His) is 59 a.a., with molecular weight of 12-14 kDa.

PPY, a hormone secreted by pancreatic cells, serves as a crucial regulator of both pancreatic and gastrointestinal functions. Its mode of action likely involves signaling through the G protein-coupled receptor NPY4R2, orchestrating intricate processes to maintain homeostasis and coordinate responses within the pancreatic and gastrointestinal systems.

Human

HEK293

C-6*His

P01298 (A30-R88)

5539  [NCBI]

APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRYGKRHKEDTLAFSEWGSPHAAVPR

12-14 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.