PRDC/GREM2 Protein, Mouse

PRDC, encoded by the GREM2 gene, has multiple functions, including BMP and protein binding, which are critical for dorsal identity determination, embryoid body morphogenesis, and signal transduction regulation. PRDC is found extracellularly and is expressed in structures such as the cartilaginous skull, integument, intestinal smooth muscle annulus, lung, and neural tube. PRDC/GREM2 Protein, Mouse is the recombinant mouse-derived PRDC/GREM2 protein, expressed by E. coli , with tag free. The total length of PRDC/GREM2 Protein, Mouse is 147 a.a., with molecular weight of ~18 kDa.

PRDC, represented by the GREM2 gene, is a versatile protein with a spectrum of functions, including BMP binding activity, heparin binding activity, and identical protein binding activity. This protein plays crucial roles in various processes such as the determination of dorsal identity, embryonic body morphogenesis, and the regulation of signal transduction. Found in the extracellular space, PRDC is expressed in diverse structures like the chondrocranium, integument, intestine smooth muscle circular layer, lung, and neural tube. The human orthologs of this gene are implicated in tooth agenesis, emphasizing its significance in developmental processes. The broad expression pattern across multiple tissues, including the ovary and lung, underscores the widespread influence of PRDC in various physiological contexts.

Measured by its ability to inhibit BMP-4-induced alkaline phosphatase production by MC3T3-E1 mouse preosteoblast cells. The ED₅₀ for this effect is 0.04067 μg/mL in the presence of 50 ng/mL of Recombinant Human BMP-4, corresponding to a specific activity is 2.46×10⁴units/mg.

Mouse

E. coli

Tag Free

NP_035955 (R22-Q168)

23893  [NCBI]

RKNRPAGAIPSPYKDGSSNNSERWHHQIKEVLASSQEALVVTERKYLKSDWCKTQPLRQTVSEEGCRSRTILNRFCYGQCNSFYIPRHVKKEEDSFQSCAFCKPQRVTSVIVELECPGLDPPFRIKKIQKVKHCRCMSVNLSDSDKQ

Approximately 18 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 0.01% TFA, 30% Acetonitrile, pH 4.4, 5% trehalose, 5% mannitol and 0.01% Tween80.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.