1. Recombinant Proteins
  2. Others
  3. PRDC/GREM2 Protein, Mouse

PRDC, encoded by the GREM2 gene, has multiple functions, including BMP and protein binding, which are critical for dorsal identity determination, embryoid body morphogenesis, and signal transduction regulation. PRDC is found extracellularly and is expressed in structures such as the cartilaginous skull, integument, intestinal smooth muscle annulus, lung, and neural tube. PRDC/GREM2 Protein, Mouse is the recombinant mouse-derived PRDC/GREM2 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PRDC, encoded by the GREM2 gene, has multiple functions, including BMP and protein binding, which are critical for dorsal identity determination, embryoid body morphogenesis, and signal transduction regulation. PRDC is found extracellularly and is expressed in structures such as the cartilaginous skull, integument, intestinal smooth muscle annulus, lung, and neural tube. PRDC/GREM2 Protein, Mouse is the recombinant mouse-derived PRDC/GREM2 protein, expressed by E. coli , with tag free.

Background

PRDC, represented by the GREM2 gene, is a versatile protein with a spectrum of functions, including BMP binding activity, heparin binding activity, and identical protein binding activity. This protein plays crucial roles in various processes such as the determination of dorsal identity, embryonic body morphogenesis, and the regulation of signal transduction. Found in the extracellular space, PRDC is expressed in diverse structures like the chondrocranium, integument, intestine smooth muscle circular layer, lung, and neural tube. The human orthologs of this gene are implicated in tooth agenesis, emphasizing its significance in developmental processes. The broad expression pattern across multiple tissues, including the ovary and lung, underscores the widespread influence of PRDC in various physiological contexts.

Biological Activity

Measured by its ability to inhibit BMP-4-induced alkaline phosphatase production by MC3T3-E1 mouse preosteoblast cells. The ED50 for this effect is 0.04067 μg/mL in the presence of 50 ng/mL of Recombinant Human BMP-4, corresponding to a specific activity is 2.46×104units/mg.

Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

O88273/NP_035955 (R22-Q168)

Gene ID
Molecular Construction
N-term
PRDC (R22-Q168)
Accession # O88273/NP_035955
C-term
Synonyms
Gremlin-2; Grem2; Cysteine knot superfamily 1, BMP antagonist 2; Protein related to DAN and cerberus; PRDC; Cktsf1b2; Protein Related to DAN and Cerberus/Gremlin-2
AA Sequence

RKNRPAGAIPSPYKDGSSNNSERWHHQIKEVLASSQEALVVTERKYLKSDWCKTQPLRQTVSEEGCRSRTILNRFCYGQCNSFYIPRHVKKEEDSFQSCAFCKPQRVTSVIVELECPGLDPPFRIKKIQKVKHCRCMSVNLSDSDKQ

Molecular Weight

Approximately 18 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 0.01% TFA, 30% Acetonitrile, pH 4.4, 5% trehalose, 5% mannitol and 0.01% Tween80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PRDC/GREM2 Protein, Mouse Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PRDC/GREM2 Protein, Mouse
Cat. No.:
HY-P79104
Quantity:
MCE Japan Authorized Agent: