Prolactin Protein, Mouse (His)

Prolactin Protein, acting on the mammary gland, plays a pivotal role in promoting lactation through interaction with its receptor, PRLR, facilitating the lactation process.Prolactin Protein, Mouse (His) is the recombinant mouse-derived Prolactin protein, expressed by E.coli , with N-6*His labeled tag.

Prolactin is a protein that plays a pivotal role in promoting lactation by primarily acting on the mammary gland. It achieves this by interacting with its specific receptor, PRLR, which facilitates the lactation process.

Measured in a cell proliferation assay using Nb2-11 rat lymphoma cells.The ED₅₀ for this effect is 0.9128-4.279 ng/mL, corresponding to a specific activity is 2.336×10⁵-1.096×10⁶ units/mg.

• 
  Measured in a cell proliferation assay using Nb211 rat lymphoma cells.The ED₅₀ for this effect is 4.279 ng/mL, corresponding to a specific activity is 2.336×10⁵ units/mg.

Mouse

E. coli

N-6*His

P06879 (L30-C226)

19109  [NCBI]

LPICSAGDCQTSLRELFDRVVILSHYIHTLYTDMFIEFDKQYVQDREFMVKVINDCPTSSLATPEDKEQALKVPPEVLLNLILSLVQSSSDPLFQLITGVGGIQEAPEYILSRAKEIEEQNKQLLEGVEKIISQAYPEAKGNGIYFVWSQLPSLQGVDEESKILSLRNTIRCLRRDSHKVDNFLKVLRCQIAHQNNC

Approximately 23 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, 200 mM arginine, pH 8.0 or PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.