1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Carboxypeptidase
  4. PSMA3 Protein, Human (His)

PSMA3 is a protein involved in protein degradation. PSMA3 Protein, Human (His) is the recombinant human-derived PSMA3 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PSMA3 is a protein involved in protein degradation. PSMA3 Protein, Human (His) is the recombinant human-derived PSMA3 protein, expressed by E. coli , with N-His labeled tag.

Background

PSMA3, a crucial component of the 20S core proteasome complex, plays a pivotal role in the ATP-dependent degradation of ubiquitinated proteins, contributing to the maintenance of protein homeostasis. When associated with two 19S regulatory particles, it forms the 26S proteasome, which is integral in removing misfolded or damaged proteins to preserve cellular functions. In conjunction with PA200 or PA28, the 20S proteasome facilitates ubiquitin-independent protein degradation, vital for processes like spermatogenesis and the generation of MHC class I-presented antigenic peptides. PSMA3 also binds to the C-terminus of CDKN1A, mediating its degradation, and negatively regulates the membrane trafficking of the cell-surface thromboxane A2 receptor isoform 2. The 26S proteasome, comprising a 20S proteasome core and two 19S regulatory subunits, functions as a barrel-shaped complex made of 28 subunits arranged in four stacked rings. The proteolytic activity of the 20S core is executed by three beta-subunits, PSMB5, PSMB6, and PSMB7. PSMA3 further engages in protein interactions with AURKB, CDKN1A, MDM2, RB1, TBXA2R isoform 2, and DNAJB2, underscoring its versatile roles in cellular regulatory pathways.

Biological Activity

Measured by its ability to inhibit the proliferation of SK-OV-3 cells. The ED50 for this effect is 0.1116 μg/mL, Corresponding to a specific activity is 8.960×103 Unit/mg.

  • Measured by its ability to inhibit the proliferation of SK-OV-3 cells. The ED50 for this effect is 0.1116 μg/mL, Corresponding to a specific activity is 8.960×103 Unit/mg.
Species

Human

Source

E. coli

Tag

N-6*His

Accession

P25788-1 (M1-M255)

Gene ID
Molecular Construction
N-term
His
PSMA3 (M1-M255)
Accession # P25788-1
C-term
Synonyms
Proteasome subunit alpha type-3; Macropain subunit C8; PSMA3; HC8; PSC8
AA Sequence

MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDNM

Molecular Weight

Approximately 30 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PSMA3 Protein, Human (His) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PSMA3 Protein, Human (His)
Cat. No.:
HY-P75988
Quantity:
MCE Japan Authorized Agent: