1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. PTP4A2 Protein, Human (His)

The PTP4A2 protein is an influential tyrosine phosphatase that stimulates G1 to S phase progression and contributes to cell cycle regulation. Notably, it promotes tumorigenesis, revealing its involvement in cancer development. PTP4A2 Protein, Human (His) is the recombinant human-derived PTP4A2 protein, expressed by E. coli , with C-6*His labeled tag. The total length of PTP4A2 Protein, Human (His) is 167 a.a., with molecular weight of ~20 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PTP4A2 protein is an influential tyrosine phosphatase that stimulates G1 to S phase progression and contributes to cell cycle regulation. Notably, it promotes tumorigenesis, revealing its involvement in cancer development. PTP4A2 Protein, Human (His) is the recombinant human-derived PTP4A2 protein, expressed by E. coli , with C-6*His labeled tag. The total length of PTP4A2 Protein, Human (His) is 167 a.a., with molecular weight of ~20 kDa.

Background

PTP4A2 protein, a potent protein tyrosine phosphatase, plays a pivotal role in stimulating the progression from G1 into S phase during mitosis, contributing to cell cycle regulation. Intriguingly, PTP4A2 emerges as a promoter of tumorigenesis, showcasing its involvement in pathological processes associated with cancer development. Additionally, PTP4A2 exhibits inhibitory effects on geranylgeranyl transferase type II activity by disrupting the association between RABGGTA and RABGGTB, indicating its regulatory influence on intracellular signaling pathways. The multifaceted functions of PTP4A2 underscore its significance in cellular processes related to both cell cycle dynamics and the intricate mechanisms underlying tumor progression.

Biological Activity

Measured by its ability to cleave a substrate, p-Nitrophenyl phosphate (pNPP). which can be measured by absorbance at 410 nm. The specific activity is 158.928 pmol/min/µg, as measured under the described conditions.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

Q12974 (M1-Q167)

Gene ID
Molecular Construction
N-term
PTP4A2 (M1-Q167)
Accession # Q12974
6*His
C-term
Synonyms
Protein tyrosine phosphatase type IVA 2; PTP4A2; HU-PP-1; OV-1; PTP(CAAXII); Protein-tyrosine phosphatase 4a2; Protein-tyrosine phosphatase of regenerating liver 2; PRL-2
AA Sequence

MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDGAPPPNQIVDDWLNLLKTKFREEPGCCVAVHCVAGLGRAPVLVALALIECGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFRDTNGHCCVQ

Molecular Weight

Approximately 20 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PTP4A2 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PTP4A2 Protein, Human (His)
Cat. No.:
HY-P71245
Quantity:
MCE Japan Authorized Agent: