PTPMT1 Protein, Human (His)

The PTPMT1 protein is a lipid phosphatase that critically regulates cellular lipid metabolism by dephosphorylating phosphatidylglycerolphosphate (PGP) to form phosphatidylglycerol (PG). This step is critical for the biosynthesis of cardiolipin, a key mitochondrial phospholipid that regulates membrane integrity and mitochondrial activity. PTPMT1 Protein, Human (His) is the recombinant human-derived PTPMT1 protein, expressed by E. coli , with N-His labeled tag.

PTPMT1 protein functions as a lipid phosphatase with a key role in cellular lipid metabolism. It catalyzes the dephosphorylation of phosphatidylglycerophosphate (PGP) to phosphatidylglycerol (PG), a crucial step in the biosynthetic pathway of cardiolipin—an essential mitochondrial phospholipid that regulates membrane integrity and mitochondrial activities. Beyond its lipid-related functions, PTPMT1 exhibits phosphatase activity toward phosphoprotein substrates, particularly involved in the dephosphorylation of mitochondrial proteins. This activity is crucial for ATP production and plays a role in the regulation of insulin secretion in pancreatic beta cells. Additionally, PTPMT1 is implicated in preventing intrinsic apoptosis, likely by regulating mitochondrial membrane integrity.

Measured by its ability to cleave pNPP. The specific activity is 666.88 pmoles/min/μg.

Human

E. coli

N-His

Q8WUK0-1 (K28-T201)

114971  [NCBI]

KVPGRAHRDWYHRIDPTVLLGALPLRSLTRQLVQDENVRGVITMNEEYETRFLCNSSQEWKRLGVEQLRLSTVDMTGIPTLDNLQKGVQFALKYQSLGQCVYVHCKAGRSRSATMVAAYLIQVHKWSPEEAVRAIAKIRSYIHIRPGQLDVLKEFHKQITARATKDGTFVISKT

Approximately 22 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.