1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. RAB1B Protein, Human (HEK293, Fc)

The RAB1B protein is an important small GTPase that regulates intracellular membrane trafficking by coordinating vesicular processes through cycling between GDP and GTP forms. It recruits downstream effectors to achieve vesicle functions, including formation, movement, and fusion. RAB1B Protein, Human (HEK293, Fc) is the recombinant human-derived RAB1B protein, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg USD 40 In-stock
10 μg USD 70 In-stock
50 μg USD 200 In-stock
100 μg USD 340 In-stock
> 100 μg   Get quote  

Get it by May 1 for select sizes. Order within 16 hrs 39 mins.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The RAB1B protein is an important small GTPase that regulates intracellular membrane trafficking by coordinating vesicular processes through cycling between GDP and GTP forms. It recruits downstream effectors to achieve vesicle functions, including formation, movement, and fusion. RAB1B Protein, Human (HEK293, Fc) is the recombinant human-derived RAB1B protein, expressed by HEK293 , with N-hFc labeled tag.

Background

The small GTPase Rab1B is a crucial regulator of intracellular membrane trafficking, orchestrating various stages from the formation of transport vesicles to their fusion with membranes. Operating through a cycle between an inactive GDP-bound form and an active GTP-bound form, Rab1B plays a pivotal role in recruiting downstream effectors responsible for vesicle processes, including formation, movement, tethering, and fusion. Notably, Rab1B contributes to the early stages of autophagic vacuole development, particularly at specialized regions of the endoplasmic reticulum. Additionally, it is involved in regulating vesicular transport between the endoplasmic reticulum and successive Golgi compartments, influencing the compacted morphology of the Golgi and facilitating the recruitment of lipid phosphatase MTMR6 to the endoplasmic reticulum-Golgi intermediate compartment.

Biological Activity

Measured in a cell proliferation assay using A549 cells. The ED50 for this effect is 3.355 ng/mL, corresponding to a specific activity is 2.98×105 units/mg.

  • Measured in a cell proliferation assay using A549 cells. The ED50 for this effect is 3.355 ng/mL, corresponding to a specific activity is 2.98×105 units/mg.
Species

Human

Source

HEK293

Tag

N-hFc

Accession

Q9H0U4 (M1-G199)

Gene ID
Molecular Construction
N-term
hFc
RAB1B (M1-G199)
Accession # Q9H0U4
C-term
Synonyms
Ras-related protein Rab-1B; RAB1B
AA Sequence

MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGG

Molecular Weight

Approximately 58 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

RAB1B Protein, Human (HEK293, Fc) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RAB1B Protein, Human (HEK293, Fc)
Cat. No.:
HY-P75993
Quantity:
MCE Japan Authorized Agent: