RBM14 Protein, Human (His-SUMO)

The RBM14 protein has different isoforms with multiple functions. Isoform 1 enhances transcription as a nuclear receptor coactivator, interacting with NCOA6 and CITED1. RBM14 Protein, Human (His-SUMO) is the recombinant human-derived RBM14 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag. The total length of RBM14 Protein, Human (His-SUMO) is 669 a.a., with molecular weight of ~85.5 kDa.

RBM14 protein exhibits diverse functional roles depending on its isoform. Isoform 1 acts as a nuclear receptor coactivator, enhancing transcription through interactions with coactivators such as NCOA6 and CITED1. In contrast, Isoform 2 functions as a transcriptional repressor, modulating the activities of coactivators, including Isoform 1, NCOA6, and CITED1. Notably, RBM14 is implicated in the regulation of centriole biogenesis, where it suppresses the formation of aberrant centriolar protein complexes, ensuring the integrity of the mitotic spindle. Additionally, RBM14 plays a crucial role in the DNA virus-mediated innate immune response by assembling into the HDP-RNP complex, serving as a platform for IRF3 phosphorylation and activating the innate immune response through the cGAS-STING pathway. Interactions with various proteins, including NCOA6, CITED1, XRCC5/KU86, SS18 isoforms, STIL, and gamma-tubulin, underscore its involvement in multiple cellular processes and signaling pathways. Furthermore, RBM14's incorporation into the HDP-RNP complex highlights its role in orchestrating innate immune responses against DNA viruses.

Human

E. coli

N-SUMO;N-6*His

Q96PK6 (M1-M669)

10432  [NCBI]

MKIFVGNVDGADTTPEELAALFAPYGTVMSCAVMKQFAFVHMRENAGALRAIEALHGHELRPGRALVVEMSRPRPLNTWKIFVGNVSAACTSQELRSLFERRGRVIECDVVKDYAFVHMEKEADAKAAIAQLNGKEVKGKRINVELSTKGQKKGPGLAVQSGDKTKKPGAGDTAFPGTGGFSATFDYQQAFGNSTGGFDGQARQPTPPFFGRDRSPLRRSPPRASYVAPLTAQPATYRAQPSVSLGAAYRAQPSASLGVGYRTQPMTAQAASYRAQPSVSLGAPYRGQLASPSSQSAAASSLGPYGGAQPSASALSSYGGQAAAASSLNSYGAQGSSLASYGNQPSSYGAQAASSYGVRAAASSYNTQGAASSLGSYGAQAASYGAQSAASSLAYGAQAASYNAQPSASYNAQSAPYAAQQAASYSSQPAAYVAQPATAAAYASQPAAYAAQATTPMAGSYGAQPVVQTQLNSYGAQASMGLSGSYGAQSAAAATGSYGAAAAYGAQPSATLAAPYRTQSSASLAASYAAQQHPQAAASYRGQPGNAYDGAGQPSAAYLSMSQGAVANANSTPPPYERTRLSPPRASYDDPYKKAVAMSKRYGSDRRLAELSDYRRLSESQLSFRRSPTKSSLDYRRLPDAHSDYARYSGSYNDYLRAAQMHSGYQRRM

Approximately 85.5 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm sterile filtered 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.