RCN3 Protein, Human (HEK293, His)

The RCN3 protein is a possible molecular chaperone that contributes to endoplasmic reticulum protein biosynthesis and transport. RCN3 is critical for pulmonary surfactant homeostasis and is required for the correct biosynthesis and transport of SP-A, SP-D, and ABCA3. RCN3 Protein, Human (HEK293, His) is the recombinant human-derived RCN3 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of RCN3 Protein, Human (HEK293, His) is 308 a.a., with molecular weight of ~43.0 kDa.

RCN3 protein is a probable molecular chaperone that assists in protein biosynthesis and transport within the endoplasmic reticulum. It is required for the proper biosynthesis and transport of pulmonary surfactant-associated proteins A/SP-A and D/SP-D, as well as the lipid transporter ABCA3. By regulating the expression and degradation of these proteins through the endoplasmic reticulum-associated protein degradation pathway, RCN3 plays a crucial role in maintaining pulmonary surfactant homeostasis. Additionally, it exhibits anti-fibrotic activity by negatively regulating the secretion of type I and type III collagens. RCN3 is known to transiently associate with immature PCSK6 and is involved in its maturation and secretion.

Human

HEK293

C-6*His

Q96D15 (K21-L328)

57333  [NCBI]

KPSPDAGPHGQGRVHQAAPLSDAPHDDAHGNFQYDHEAFLGREVAKEFDQLTPEESQARLGRIVDRMDRAGDGDGWVSLAELRAWIAHTQQRHIRDSVSAAWDTYDTDRDGRVGWEELRNATYGHYAPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVIAETLEDLDRNKDGYVQVEEYIADLYSAEPGEEEPAWVQTERQQFRDFRDLNKDGHLDGSEVGHWVLPPAQDQPLVEANHLLHESDTDKDGRLSKAEILGNWNMFVGSQATNYGEDLTRHHDEL

Approximately 43.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 1 mM DTT, 10% Glycerol, pH 7.4.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.