1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. EGF Superfamily
  4. Neuregulins
  5. Neuregulin-1 (NRG1)
  6. NRG1-beta 1 Protein, Human

NRG1-beta 1 Protein, Human

Cat. No.: HY-P7365
COA Handling Instructions

HRG1-β1 belongs to a family of structurally-related polypeptide growth factors derived from alternatively spliced genes, induces Fn14 expression in MCF7 cells. NRG-1 Protein, Human is the recombinant human-derived HRG1-β1, expressed by E. coli , with tag Free labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample (2 μg)   Apply now
2 μg $35 In-stock
10 μg $90 In-stock
50 μg $190 In-stock
100 μg $300 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

HRG1-β1 belongs to a family of structurally-related polypeptide growth factors derived from alternatively spliced genes, induces Fn14 expression in MCF7 cells. NRG-1 Protein, Human is the recombinant human-derived HRG1-β1, expressed by E. coli , with tag Free labeled tag.

Background

HRG1-β1 activates HER2/HER3 signaling and up-regulate Fn14 gene expression in parental MCF7 cells. HRG1-β1-mediated Fn14 up-regulation in MCF7/HER2-18 cells is required for maximal MMP-9 production.

Biological Activity

Measured in a serum-free cell proliferation assay using MCF-7 human breast cancer cells. The ED50 this effect is ≤ 2.158 ng/mL, corresponding to a specific activity is ≥ 4.6339×105 units/mg.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q02297-6 (S177-E241)

Gene ID
Molecular Construction
N-term
NRG1-beta 1 (S177-E241)
Accession # Q02297-6
C-term
Synonyms
rHuHeregulin-1 β1; ARIA; HRG; NRG1; Neuregulin-1
AA Sequence

SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAE

Molecular Weight

Approximately 8 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from sterile PBS or 50 mM Tris-HCL, 300 mM NaCl, 200 mM arginine, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

NRG1-beta 1 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NRG1-beta 1 Protein, Human
Cat. No.:
HY-P7365
Quantity:
MCE Japan Authorized Agent: