IL-3 Protein, Mouse (His)

IL-3 Protein, Mouse (His) is a pleiotropic cytokine containing 135 amino acids, which functions via specific cell surface receptors to stimulate the proliferation, differentiation and survival of haematopoietic cell lines.

Interleukin-3 (IL-3) is aglycoprotein belonging to the hematopoietic growth factor family that in preclinical in vitro and in vivo studies has exhibited a multilineage activity. Recombinant human interleukin-3 (rhIL-3) enhances the mobilization of peripheral blood progenitor cells by recombinant human granulocyte colony-stimulating factor (rhG-CSF)^[1]. Human interleukin-3 (hIL-3) is a multipotent hematopoietic cytokine produced by mitogen and antigen-activated keratinocytes, T-lymphocytes, mast cells, NK cells, monocytes and endothelial cells. The hematopoietic progenitor cells are proliferated and differentiated with the help of hIL-3 protein into mature erythrocytes, mast cells, megakaryocytes and granulocytes. The potential use of hIL-3 protein has been extensively tested in various clinical applications such as bone marrow transplantation, hematological malignancies, cytopenias, aplastic anemia and various types of cancer^[2].

Measured in a cell proliferation assay using M-NFS-60 cells. The ED₅₀ for this effect is 77.96 pg/mL, corresponding to a specific activity is 1.282×10⁷ units/mg.

Mouse

E. coli

N-6*His

P01586 (D33-C166)

16187  [NCBI]

DTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC

Approximately 17 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 6.5, 8% trehalose.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Huhn RD, et al. Recombinant human interleukin-3 (rhIL-3) enhances the mobilization of peripheral blood progenitor cells by recombinant human granulocyte colony-stimulating factor (rhG-CSF) in normal volunteers. Exp Hematol. 1996 Jun;24(7):839-47.  [Content Brief]

  [2]. Dagar VK, et al. Combined effect of gene dosage and process optimization strategies on high-level production of recombinant human interleukin-3 (hIL-3) in Pichia pastoris fed-batch culture. Int J Biol Macromol. 2018 Mar;108:999-1009.  [Content Brief]