1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TNF Superfamily
  4. TNF Receptor Superfamily
  5. RELT TNF Receptor
  6. RELT Protein, Human (HEK293, Fc)

RELT protein may play a role in apoptosis, suggesting its involvement in the complex cellular process of programmed cell death. When overexpressed, RELT activates the MAPK14/p38 and MAPK8/JNK MAPK cascades, affecting key signaling pathways. RELT Protein, Human (HEK293, Fc) is the recombinant human-derived RELT protein, expressed by HEK293 , with C-hFc labeled tag. The total length of RELT Protein, Human (HEK293, Fc) is 135 a.a., with molecular weight of 40-54 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

RELT protein may play a role in apoptosis, suggesting its involvement in the complex cellular process of programmed cell death. When overexpressed, RELT activates the MAPK14/p38 and MAPK8/JNK MAPK cascades, affecting key signaling pathways. RELT Protein, Human (HEK293, Fc) is the recombinant human-derived RELT protein, expressed by HEK293 , with C-hFc labeled tag. The total length of RELT Protein, Human (HEK293, Fc) is 135 a.a., with molecular weight of 40-54 kDa.

Background

The RELT protein is implicated in potentially playing a role in apoptosis, suggesting its involvement in the complex cellular process of programmed cell death. When overexpressed, RELT induces the activation of MAPK14/p38 and MAPK8/JNK MAPK cascades, indicating its influence on key signaling pathways associated with cellular responses. Additionally, RELT is identified as having a role in dental enamel formation, contributing to the intricate processes involved in tooth development. The protein interacts with various partners, including TRAF1, RELL1, RELL2, OXSR1, PLSCR1, and STK39, underscoring its versatility in molecular interactions and suggesting its potential involvement in diverse cellular functions beyond apoptosis, including signal transduction and developmental processes.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q969Z4 (S26-A160)

Gene ID
Molecular Construction
N-term
RELT (S26-A160)
Accession # Q969Z4
hFc
C-term
Synonyms
Tumor necrosis factor receptor superfamily member 19L; TNFRSF19L; Receptor expressed in lymphoid tissues; RELT
AA Sequence

STTLWQCPPGEEPDLDPGQGTLCRPCPPGTFSAAWGSSPCQPHARCSLWRRLEAQVGMATRDTLCGDCWPGWFGPWGVPRVPCQPCSWAPLGTHGCDEWGRRARRGVEVAAGASSGGETRQPGNGTRAGGPEETA

Molecular Weight

40-54 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

RELT Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RELT Protein, Human (HEK293, Fc)
Cat. No.:
HY-P71258
Quantity:
MCE Japan Authorized Agent: