RELT Protein, Human (HEK293, Fc)

RELT protein may play a role in apoptosis, suggesting its involvement in the complex cellular process of programmed cell death. When overexpressed, RELT activates the MAPK14/p38 and MAPK8/JNK MAPK cascades, affecting key signaling pathways. RELT Protein, Human (HEK293, Fc) is the recombinant human-derived RELT protein, expressed by HEK293 , with C-hFc labeled tag. The total length of RELT Protein, Human (HEK293, Fc) is 135 a.a., with molecular weight of 40-54 kDa.

The RELT protein is implicated in potentially playing a role in apoptosis, suggesting its involvement in the complex cellular process of programmed cell death. When overexpressed, RELT induces the activation of MAPK14/p38 and MAPK8/JNK MAPK cascades, indicating its influence on key signaling pathways associated with cellular responses. Additionally, RELT is identified as having a role in dental enamel formation, contributing to the intricate processes involved in tooth development. The protein interacts with various partners, including TRAF1, RELL1, RELL2, OXSR1, PLSCR1, and STK39, underscoring its versatility in molecular interactions and suggesting its potential involvement in diverse cellular functions beyond apoptosis, including signal transduction and developmental processes.

Human

HEK293

C-hFc

Q969Z4 (S26-A160)

84957  [NCBI]

STTLWQCPPGEEPDLDPGQGTLCRPCPPGTFSAAWGSSPCQPHARCSLWRRLEAQVGMATRDTLCGDCWPGWFGPWGVPRVPCQPCSWAPLGTHGCDEWGRRARRGVEVAAGASSGGETRQPGNGTRAGGPEETA

40-54 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.