RNASE6 Protein, Human (HEK293, His)

RNASE6 Protein, a pyrimidine-preferring ribonuclease, exhibits potent antibacterial activity against diverse bacteria, including P. aeruginosa, A. baumanii, and E. coli. Its effect is independent of ribonuclease activity, inducing bacterial membrane disruption and Gram-negative bacteria agglutination, emphasizing its bactericidal properties. RNASE6's robust antibacterial activity suggests a potential role in preserving urinary tract sterility. RNASE6 Protein, Human (HEK293, His) is the recombinant human-derived RNASE6 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of RNASE6 Protein, Human (HEK293, His) is 127 a.a., with molecular weight of ~22.0 kDa.

The RNASE6 protein, functioning as a ribonuclease, exhibits a distinct preference for the pyrimidines uridine and cytosine. This ribonuclease demonstrates potent antibacterial activity against a broad spectrum of bacteria, including P. aeruginosa, A. baumanii, M. luteus, S. aureus, E. faecalis, E. faecium, S. saprophyticus, and E. coli. Notably, RNASE6's antibacterial effect is independent of its ribonuclease activity. The protein induces bacterial membrane disruption and promotes the agglutination of Gram-negative bacteria, contributing to its bactericidal properties. RNASE6's formidable antibacterial activity suggests its potential role in maintaining urinary tract sterility.

Human

HEK293

C-6*His

Q93091 (W24-L150)

6039  [NCBI]

WPKRLTKAHWFEIQHIQPSPLQCNRAMSGINNYTQHCKHQNTFLHDSFQNVAAVCDLLSIVCKNRRHNCHQSSKPVNMTDCRLTSGKYPQCRYSAAAQYKFFIVACDPPQKSDPPYKLVPVHLDSIL

Approximately 22.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.