RYK Protein, Human (HEK293, Fc)

RYK protein, together with FZD8, serves as a potential Wnt co-receptor for WNT1, WNT3, WNT3A and WNT5A, affecting neuronal differentiation, axon guidance and neurite growth. After WNT3 stimulation, RYK undergoes C-terminal cleavage and transfers intracellular products to the nucleus, which is critical for neuronal development. RYK Protein, Human (HEK293, Fc) is the recombinant human-derived RYK protein, expressed by HEK293 , with C-hFc labeled tag.

RYK Protein appears to function as a potential coreceptor, collaborating with FZD8, for Wnt proteins like WNT1, WNT3, WNT3A, and WNT5A. Its involvement spans critical processes such as neuron differentiation, axon guidance, corpus callosum establishment, and neurite outgrowth, emphasizing its significance in neural development. Upon stimulation by WNT3, the receptor undergoes C-terminal cleavage in its transmembrane region, facilitating the translocation of the C-terminal intracellular product from the cytoplasm to the nucleus. This translocated product assumes a crucial role in mediating neuronal development. The multifaceted engagement of RYK in Wnt signaling pathways underscores its potential as a key player in orchestrating intricate cellular processes integral to neural differentiation and growth. Further exploration of RYK's functions and regulatory mechanisms may provide deeper insights into its specific contributions to neuronal development.

Measured by its binding ability in a functional ELISA. Immobilized Human RYK, at 2μg/mL (100 μL/well) can bind Wnt3a. The KD for this effect is 5.675 nM.

Human

HEK293

C-hFc

P34925/NP_002949.2 (P26-R227)

6259  [NCBI]

PPPLLLLLALLPLLPAPGAAAAPAPRPPELQSASAGPSVSLYLSEDEVRRLIGLDAELYYVRNDLISHYALSFSLLVPSETNFLHFTWHAKSKVEYKLGFQVDNVLAMDMPQVNISVQGEVPRTLSVFRVELSCTGKVDSEVMILMQLNLTVNSSKNFTVLNFKRRKMCYKKLEEVKTSALDKNTSRTIYDPVHAAPTTSTR

Approximately 49.1 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.