1. Recombinant Proteins
  2. Others
  3. S100A10 Protein, Human (His)

S100A10 Protein is pivotal in modulating protein phosphorylation by promoting ANXA2/p36 dimerization. The ANXA2 monomer is the favored substrate for tyrosine-specific kinase activity in vitro. A heterotetramer, composed of S100A10/p11 and ANXA2/p36, highlights intricate regulatory dynamics. This interaction landscape includes SCN10A and TASOR, showcasing S100A10's multifaceted involvement in cellular processes. S100A10 Protein, Human (His) is the recombinant human-derived S100A10 protein, expressed by E. coli , with N-6*His labeled tag. The total length of S100A10 Protein, Human (His) is 96 a.a., with molecular weight of ~13 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

S100A10 Protein is pivotal in modulating protein phosphorylation by promoting ANXA2/p36 dimerization. The ANXA2 monomer is the favored substrate for tyrosine-specific kinase activity in vitro. A heterotetramer, composed of S100A10/p11 and ANXA2/p36, highlights intricate regulatory dynamics. This interaction landscape includes SCN10A and TASOR, showcasing S100A10's multifaceted involvement in cellular processes. S100A10 Protein, Human (His) is the recombinant human-derived S100A10 protein, expressed by E. coli , with N-6*His labeled tag. The total length of S100A10 Protein, Human (His) is 96 a.a., with molecular weight of ~13 kDa.

Background

S100A10 protein plays a pivotal role in modulating protein phosphorylation by promoting the dimerization of ANXA2/p36. The ANXA2 monomer emerges as the preferred substrate for tyrosine-specific kinase activity in vitro. Furthermore, the formation of a heterotetramer, consisting of two light chains of S100A10/p11 and two heavy chains of ANXA2/p36, underscores the intricate regulatory dynamics. This interaction landscape extends to include SCN10A and TASOR, emphasizing the multifaceted involvement of S100A10 in cellular processes.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P60903 (P2-K97)

Gene ID
Molecular Construction
N-term
6*His
S100A10 (P2-K97)
Accession # P60903
C-term
Synonyms
Protein S100-A10; p11; S100A10; ANX2LG; CAL1L; CLP11
AA Sequence

PSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK

Molecular Weight

Approximately 13 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

S100A10 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
S100A10 Protein, Human (His)
Cat. No.:
HY-P74586
Quantity:
MCE Japan Authorized Agent: