S100A9 Protein, Mouse (His)

S100A9 Protein is a calcium- and zinc-binding protein which belongs to the S100 family that primarily expresses in neutrophils and monocytes.S100A9 can induce neutrophil chemotaxis, adhesion, can increase the bactericidal activity of neutrophils by promoting phagocytosis via activation of SYK, PI3K/AKT, and ERK1/2.S100A9 has pro-inflammatory, antimicrobial, oxidant-scavenging and apoptosis-inducing activities which plays an important role in the regulation of inflammatory processes and immune response.S100A9 Protein, Mouse (His) is the recombinant mouse-derived S100A9 protein, expressed by E.coli , with N-His labeled tag.

S100A9 is a calcium- and zinc-binding protein which belongs to the S100 family that primarily expresses in neutrophils and monocytes. S100A9 can induce neutrophil chemotaxis, adhesion, can increase the bactericidal activity of neutrophils by promoting phagocytosis via activation of SYK, PI3K/AKT, and ERK1/2 and can induce degranulation of neutrophils by a MAPK-dependent mechanism. S100A9 promotes leukocyte arachidonic acid transport and metabolism, tubulin-dependent cytoskeletal regulation during phagocyte migration and activation of the neutrophilic NADPH oxidase. S100A9 has pro-inflammatory, antimicrobial, oxidant-scavenging and apoptosis-inducing activities.S100A9 acts as an alarmin or a danger associated molecular pattern (DAMP) molecule and stimulates innate immune cells via binding to pattern recognition receptors and receptor for advanced glycation endproducts (AGER). S100A9 binds to TLR4 and AGER activates the MAP-kinase and NF-kappa-B signaling pathways, leading to amplification of the pro-inflammatory cascade. S100A9 has antimicrobial activity towards bacteria and fungi and exerts its antimicrobial activity probably via chelation of Zn2+ which is essential for microbial growth. S100A9 can regulate neutrophil number and apoptosis by an anti-apoptotic effect; regulates cell survival via ITGAM/ITGB and TLR4 and a signaling mechanism involving MEK-ERK. S100A9 plays an important role in the regulation of inflammatory processes and immune response^{[1][2][3][4][5][6][7]}.

Measured by its ability to induce CXCL1/KC secretion by C3H10T1/2 mouse embryonic fibroblast cells .The ED₅₀ for this effect is 0.4264-0.8299 μg/mL, corresponding to a specific activity is 1.20× 10³-2.345 × 10³ units/mg.

• 
  Measured by its ability to induce CXCL1/KC secretion by C3H10T1/2 mouse embryonic fibroblast cells. The ED₅₀ for this effect is 0.4264 μg/mL, corresponding to a specific activity is 2.345 × 10³ units/mg determined by ELISA.
• 
  Measured by its ability to induce CXCL1/KC secretion by C3H10T1/2 mouse embryonic fibroblast cells. The ED₅₀ for this effect is 0.8299 μg/mL, corresponding to a specific activity is 1.20× 10³ units/mg determined by qRT-PCR.

Mouse

E. coli

N-His

P31725 (A2-K113)

20202  [NCBI]

ANKAPSQMERSITTIIDTFHQYSRKEGHPDTLSKKEFRQMVEAQLATFMKKEKRNEALINDIMEDLDTNQDNQLSFEECMMLMAKLIFACHEKLHENNPRGHGHSHGKGCGK

16-20 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of sterile 50 mM Tris-HCL, 300 mM NaCl, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. The specifaction of 5/10/50/100/500/1000 μg is recommended to reconstitute to a concentration of200/200/500/500/2000/2000 μg/mL in sterilized water respectively. For concentration less than that, pleasereconstitute in 50 mM Tris-HCL, 300 mM NaCl, pH 7.4 buffer.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.