1. Recombinant Proteins
  2. Others
  3. S100B Protein, Mouse (His)

S100B Protein, Mouse (His)

Cat. No.: HY-P71276
SDS COA Handling Instructions

The S100B protein is a small zinc and calcium binding protein abundant in astrocytes with unique calcium and zinc binding sites of varying affinities.Although it binds weakly to calcium, it binds tightly to zinc, and potassium ions antagonize both.S100B Protein, Mouse (His) is the recombinant mouse-derived S100B protein, expressed by E.coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The S100B protein is a small zinc and calcium binding protein abundant in astrocytes with unique calcium and zinc binding sites of varying affinities.Although it binds weakly to calcium, it binds tightly to zinc, and potassium ions antagonize both.S100B Protein, Mouse (His) is the recombinant mouse-derived S100B protein, expressed by E.coli , with C-6*His labeled tag.

Background

S100B, a small zinc- and calcium-binding protein highly expressed in astrocytes and abundant in the brain, possesses distinct binding sites for calcium and zinc with varying affinities. While weakly binding calcium, it exhibits tight binding to zinc. Physiological concentrations of potassium ion can antagonize the binding of both divalent cations, particularly affecting high-affinity calcium-binding sites. Functionally, S100B acts as a neurotrophic factor, promoting astrocytosis and axonal proliferation. It also plays a role in the innervation of thermogenic adipose tissue, acting as an adipocyte-derived neurotrophic factor that promotes sympathetic innervation. S100B initiates the activation of STK38 by releasing autoinhibitory intramolecular interactions within the kinase. Post-myocardial infarction, its interaction with AGER may contribute to myocyte apoptosis through the activation of ERK1/2 and p53/TP53 signaling. Additionally, S100B could aid in ATAD3A cytoplasmic processing, preventing aggregation and facilitating mitochondrial localization. Its role extends to mediating calcium-dependent regulation in various physiological processes by interacting with proteins like TPR-containing proteins, modulating their activity. Structurally, S100B forms dimers composed of either two alpha chains, two beta chains, or one alpha and one beta chain, interacting with a multitude of proteins, including CACYBP, ATAD3A, S100A6, CAPZA1, PPP5C, TPPP, and CLSTN3beta, influencing diverse cellular functions.

Species

Mouse

Source

E. coli

Tag

C-6*His

Accession

P50114 (M1-E92)

Gene ID
Molecular Construction
N-term
S100B (M1-E92)
Accession # P50114
6*His
C-term
Synonyms
Protein S100-B; S-100 protein beta chain; S-100 protein subunit beta; S100 calcium-binding protein B; S100b; S100 beta; S100 calcium binding protein B
AA Sequence

MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVAMVTTACHEFFEHE

Molecular Weight

Approximately 11.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

S100B Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
S100B Protein, Mouse (His)
Cat. No.:
HY-P71276
Quantity:
MCE Japan Authorized Agent: