SARS-CoV-2 PLpro Protein

The multifunctional SARS-CoV-2 PP1ab protein is essential for viral RNA transcription and replication, utilizing proteases for multi-protein cleavage. It inhibits host translation by binding to the 40S subunit and blocks ribosomal mRNA entry channels, thereby hindering the antiviral response. SARS-CoV-2 PLpro Protein is the recombinant Virus-derived SARS-CoV-2 PLpro protein, expressed by E. coli , with tag free. The total length of SARS-CoV-2 PLpro Protein is 315 a.a., with molecular weight of ~34.0 kDa.

The SARS-CoV-2 PP1ab protein is a multifunctional component crucial for the transcription and replication of viral RNAs, housing the proteinases responsible for polyprotein cleavages. This protein plays a pivotal role in inhibiting host translation by associating with the open head conformation of the 40S subunit, and its C-terminus obstructs the ribosomal mRNA entry tunnel, thereby impeding the antiviral response triggered by innate immunity or interferons. The formation of the nsp1-40S ribosome complex leads to an endonucleolytic cleavage near the 5'UTR of host mRNAs, facilitating their degradation. Notably, viral mRNAs exhibit greater resistance to the nsp1-mediated inhibition of translation due to their 5'-end leader sequence. This multifaceted functionality underscores the strategic role of SARS-CoV-2 PP1ab in manipulating host cellular processes for the benefit of viral replication and evasion of host defenses.

PLpro/papain-like protease(Plpro) can hydrolyze Arg-Leu-Arg-Gly-Gly-AMC to produce AMC, and the activity of PLpro is calculated by measuring the amount of product AMC produced at the excitation wavelength of 380nm and the emission wavelength of 460nm. The specific activity is 124.43pmol/min/μg.

Virus

E. coli

Tag Free

P0DTD1-1 (E1564-K1878)

43740578  [NCBI]

EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIK

Approximately 34.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 10 mM 2-Mercaptoethanol, 20% Glycerol, pH 7.5.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.