SECTM1 Protein, Human (HEK293, His)

SECTM1 Protein potentially influences thymocyte signaling, indicating a role in thymic regulatory mechanisms. Its interaction with CD7 suggests involvement in cellular processes, potentially influencing thymocyte-associated signaling pathways. SECTM1's significance in thymocyte function and interaction with CD7 hints at a role in modulating immune responses and cellular communication within the thymic microenvironment. SECTM1 Protein, Human (HEK293, His) is the recombinant human-derived SECTM1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of SECTM1 Protein, Human (HEK293, His) is 117 a.a., with molecular weight of 18-22 kDa.

The SECTM1 protein appears to play a potential role in thymocyte signaling, suggesting its involvement in the complex regulatory mechanisms within the thymus. Its interaction with CD7 further underscores its role in these cellular processes, hinting at a possible influence on the signaling pathways associated with thymocytes. The significance of SECTM1 in the context of thymocyte function and its interaction with CD7 implies a potential role in modulating immune responses and cellular communication within the thymic microenvironment.

Human

HEK293

C-6*His

Q8WVN6 (Q29-G145)

6398  [NCBI]

QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTG

18-22 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.