1. Recombinant Proteins
  2. Others
  3. SELM Protein, Human

SELM Protein, Human

Cat. No.: HY-P71603
SDS COA Handling Instructions

SELM protein emerged as a potential thiol-disulfide bond oxidoreductase that plays a key role in the complex disulfide bond formation process. This highlights the importance of SELM proteins in cellular machinery, actively contributing to the delicate coordination of molecular interactions. SELM Protein, Human is the recombinant human-derived SELM protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg $190 In-stock
50 μg $420 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SELM protein emerged as a potential thiol-disulfide bond oxidoreductase that plays a key role in the complex disulfide bond formation process. This highlights the importance of SELM proteins in cellular machinery, actively contributing to the delicate coordination of molecular interactions. SELM Protein, Human is the recombinant human-derived SELM protein, expressed by E. coli , with tag free.

Background

SELM Protein takes center stage as a potential thiol-disulfide oxidoreductase, playing a pivotal role in the intricate process of disulfide bond formation. This attribution highlights SELM Protein's significance in cellular mechanisms, actively contributing to the nuanced orchestration of molecular interactions. Such functional insights position SELM Protein as a key molecular actor, revealing its involvement in the complex biochemical pathways that govern the establishment of crucial disulfide linkages within the cellular milieu.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q8WWX9 (A24-L145)

Gene ID
Molecular Construction
N-term
SELM (A24-L145)
Accession # Q8WWX9
C-term
Synonyms
SELENOM; SELM; Selenoprotein M; SelM
AA Sequence

ATAYRPDWNRLSGLTRARVETCGGSQLNRLKEVKAFVTQDIPFYHNLVMKHLPGADPELVLLGRRYEELERIPLSEMTREEINALVQELGFYRKAAPDAQVPPEYVWAPAKPPEETSDHADL

Molecular Weight

Approximately 17 kDa.The reducing (R) protein migrate s as 17 kDa in SDS-PAGE may b e due to relative charge.

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against solution in 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

SELM Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SELM Protein, Human
Cat. No.:
HY-P71603
Quantity:
MCE Japan Authorized Agent: