1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. SENP1 Catalytic Domain Protein, Human (His)

SENP1 Catalytic Domain Protein hydrolyzes SUMO propeptides (SUMO1, SUMO2, and SUMO3), maturing them. It also deconjugates SUMO1, SUMO2, and SUMO3 from target proteins, impacting their activities. Interacts with MTA1 and CCAR2, influencing SIRT1 interaction and transcriptional activities, showcasing its regulatory role in SUMOylation processes. SENP1 Catalytic Domain Protein, Human (His) is the recombinant human-derived SENP1 Catalytic Domain protein, expressed by E. coli , with N-His labeled tag. The total length of SENP1 Catalytic Domain Protein, Human (His) is 230 a.a., with molecular weight of ~30 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SENP1 Catalytic Domain Protein hydrolyzes SUMO propeptides (SUMO1, SUMO2, and SUMO3), maturing them. It also deconjugates SUMO1, SUMO2, and SUMO3 from target proteins, impacting their activities. Interacts with MTA1 and CCAR2, influencing SIRT1 interaction and transcriptional activities, showcasing its regulatory role in SUMOylation processes. SENP1 Catalytic Domain Protein, Human (His) is the recombinant human-derived SENP1 Catalytic Domain protein, expressed by E. coli , with N-His labeled tag. The total length of SENP1 Catalytic Domain Protein, Human (His) is 230 a.a., with molecular weight of ~30 kDa.

Background

SENP1 Catalytic Domain Protein is a protease that plays crucial roles in the SUMO pathway by catalyzing two essential functions. Firstly, it hydrolyzes an alpha-linked peptide bond at the C-terminal end of the small ubiquitin-like modifier (SUMO) propeptides, including SUMO1, SUMO2, and SUMO3, leading to the formation of mature proteins. Secondly, it deconjugates SUMO1, SUMO2, and SUMO3 from targeted proteins by cleaving an epsilon-linked peptide bond between the C-terminal glycine of the mature SUMO and the lysine epsilon-amino group of the target protein. SENP1 Catalytic Domain Protein is known to deconjugate SUMO1 from HIPK2, HDAC1, and BHLHE40/DEC1, leading to a decrease in their transcriptional repression activity. It also deconjugates SUMO1 from CLOCK, reducing its transcriptional activation activity. Additionally, SENP1 Catalytic Domain Protein deconjugates SUMO2 from MTA1 and SUMO1 from METTL3. It also desumoylates CCAR2, thereby decreasing its interaction with SIRT1. SENP1 Catalytic Domain Protein interacts with MTA1 and CCAR2 via their respective N-termini.

Biological Activity

Human His6-SENP1 Catalytic Domain is a SUMO-specific deconjugating enzyme with an initial Human His6-SENP1 Catalytic Domain concentration of 50-500 nM. A 15 minute pre-incubation with 10 mM DTT is recommended to achieve maximum activity.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q9P0U3-1 (D415-L644)

Gene ID
Molecular Construction
N-term
His
SENP1 (D415-L644)
Accession # Q9P0U3
C-term
Synonyms
Sentrin-specific protease 1; SENP1; Sentrin/SUMO-specific protease SENP1; SUMO-Specific Peptidase 1
AA Sequence

DSEDEFPEITEEMEKEIKNVFRNGNQDEVLSEAFRLTITRKDIQTLNHLNWLNDEIINFYMNMLMERSKEKGLPSVHAFNTFFFTKLKTAGYQAVKRWTKKVDVFSVDILLVPIHLGVHWCLAVVDFRKKNITYYDSMGGINNEACRILLQYLKQESIDKKRKEFDTNGWQLFSKKSQEIPQQMNGSDCGMFACKYADCITKDRPINFTQQHMPYFRKRMVWEILHRKLL

Molecular Weight

Approximately 30 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of in 50 mM HEPES, 200 mM NaCl, pH 7.4, 20% Glycerol.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

SENP1 Catalytic Domain Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SENP1 Catalytic Domain Protein, Human (His)
Cat. No.:
HY-P79459
Quantity:
MCE Japan Authorized Agent: