SENP1 Catalytic Domain Protein, Human (His)

SENP1 Catalytic Domain Protein hydrolyzes SUMO propeptides (SUMO1, SUMO2, and SUMO3), maturing them. It also deconjugates SUMO1, SUMO2, and SUMO3 from target proteins, impacting their activities. Interacts with MTA1 and CCAR2, influencing SIRT1 interaction and transcriptional activities, showcasing its regulatory role in SUMOylation processes. SENP1 Catalytic Domain Protein, Human (His) is the recombinant human-derived SENP1 Catalytic Domain protein, expressed by E. coli , with N-His labeled tag. The total length of SENP1 Catalytic Domain Protein, Human (His) is 230 a.a., with molecular weight of ~30 kDa.

SENP1 Catalytic Domain Protein is a protease that plays crucial roles in the SUMO pathway by catalyzing two essential functions. Firstly, it hydrolyzes an alpha-linked peptide bond at the C-terminal end of the small ubiquitin-like modifier (SUMO) propeptides, including SUMO1, SUMO2, and SUMO3, leading to the formation of mature proteins. Secondly, it deconjugates SUMO1, SUMO2, and SUMO3 from targeted proteins by cleaving an epsilon-linked peptide bond between the C-terminal glycine of the mature SUMO and the lysine epsilon-amino group of the target protein. SENP1 Catalytic Domain Protein is known to deconjugate SUMO1 from HIPK2, HDAC1, and BHLHE40/DEC1, leading to a decrease in their transcriptional repression activity. It also deconjugates SUMO1 from CLOCK, reducing its transcriptional activation activity. Additionally, SENP1 Catalytic Domain Protein deconjugates SUMO2 from MTA1 and SUMO1 from METTL3. It also desumoylates CCAR2, thereby decreasing its interaction with SIRT1. SENP1 Catalytic Domain Protein interacts with MTA1 and CCAR2 via their respective N-termini.

Human His6-SENP1 Catalytic Domain is a SUMO-specific deconjugating enzyme with an initial Human His6-SENP1 Catalytic Domain concentration of 50-500 nM. A 15 minute pre-incubation with 10 mM DTT is recommended to achieve maximum activity.

Human

E. coli

N-6*His

Q9P0U3-1 (D415-L644)

29843  [NCBI]

DSEDEFPEITEEMEKEIKNVFRNGNQDEVLSEAFRLTITRKDIQTLNHLNWLNDEIINFYMNMLMERSKEKGLPSVHAFNTFFFTKLKTAGYQAVKRWTKKVDVFSVDILLVPIHLGVHWCLAVVDFRKKNITYYDSMGGINNEACRILLQYLKQESIDKKRKEFDTNGWQLFSKKSQEIPQQMNGSDCGMFACKYADCITKDRPINFTQQHMPYFRKRMVWEILHRKLL

Approximately 30 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filtered solution of in 50 mM HEPES, 200 mM NaCl, pH 7.4, 20% Glycerol.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.