SENP8 Protein, Human (His)

SENP8 protein, a pivotal protease in the NEDD8 pathway, plays a dual role in catalyzing the processing of full-length NEDD8 into its mature form and facilitating the deconjugation of NEDD8 from specific target proteins, including cullins and p53. SENP8's dual functionality underscores its crucial role in regulating NEDD8 modification, impacting various cellular pathways and functions. SENP8 Protein, Human (His) is the recombinant human-derived SENP8 protein, expressed by E. coli , with N-6*His labeled tag. The total length of SENP8 Protein, Human (His) is 212 a.a., with molecular weight of ~22.0 kDa.

SENP8 protein serves as a pivotal protease in the NEDD8 pathway, playing a dual role by catalyzing the processing of full-length NEDD8 into its mature form and facilitating the deconjugation of NEDD8 from specific target proteins, including cullins and p53. This dual functionality underscores SENP8's crucial involvement in regulating NEDD8 modification, a process that has profound implications for various cellular pathways and functions.

Human

E. coli

N-6*His

Q96LD8 (M1-K212)

123228  [NCBI]

MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLITTLAKK

Approximately 22.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.