Serpin B3 Protein, Human (HEK293, His)

The Serpin B3 protein exhibits versatility in cellular regulation and may act as a papain-like cysteine protease inhibitor to modulate immune responses against tumor cells. Its dual role extends to inhibiting UV-induced apoptosis by inhibiting c-Jun NH(2)-terminal kinase (JNK1) activity, suggesting that Serpin B3 is involved in the stress response. Serpin B3 Protein, Human (HEK293, His) is the recombinant human-derived Serpin B3 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Serpin B3 Protein, Human (HEK293, His) is 390 a.a., with molecular weight of 41-50 kDa.

The Serpin B3 protein emerges as a versatile participant in cellular regulation, potentially functioning as a papain-like cysteine protease inhibitor to modulate the host immune response against tumor cells. Its dual role extends to the inhibition of UV-induced apoptosis, accomplished by suppressing the activity of c-Jun NH(2)-terminal kinase (JNK1), thereby implicating Serpin B3 in cellular processes related to stress response. The protein's interaction with MAPK8/JNK1 further underscores its intricate involvement in signaling pathways, highlighting its potential as a multifaceted regulator with implications for immune modulation and apoptosis regulation.

Human

HEK293

C-6*His

P29508 (M1-P390)

6317  [NCBI]

MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENTTGKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTSVESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP

41-50 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 0.02% Tween80, 4% Mannitol, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.