Serpin A1 Protein, Rat (HEK293, His)

The serpin A1 protein is a vigilant guardian in cell regulation, effectively inhibiting elastase and providing a strong barrier to its enzymatic activity.Serpin A1 has moderate affinity for plasmin and thrombin and exhibits versatility in binding a range of serine proteases.Serpin A1 Protein, Rat (HEK293, His) is the recombinant rat-derived Serpin A1 protein, expressed by HEK293 , with C-His labeled tag.

Serpin A1, a vigilant guardian in the intricate landscape of cellular regulation, stands as a potent inhibitor of serine proteases. Its primary target is elastase, where it acts as a formidable shield against enzymatic activity. Moreover, Serpin A1 exhibits a moderate affinity for plasmin and thrombin, showcasing its versatility in engaging with a spectrum of serine proteases. In its regulatory role, Serpin A1 establishes intricate interactions with CELA2A, ERGIC3, LMAN1/ERGIC53, and PRSS1/Trypsin, contributing to the nuanced orchestration of proteolytic processes within the cellular milieu.

Measured by its ability to inhibit trypsin cleavage of a fluorogenic peptide substrate, Mca-RPKPVE-Nval-WRK(Dnp)-NH2. The IC₅₀ value is 2.931 nM, as measured under the described conditions.

Rat

HEK293

C-His

P17475 (E25-R411)

24648  [NCBI]

EDAQETDTSQQDQSPTYRKISSNLADFAFSLYRELVHQSNTSNIFFSPMSITTAFAMLSLGSKGDTRKQILEGLEFNLTQIPEADIHKAFHHLLQTLNRPDSELQLNTGNGLFVNKNLKLVEKFLEEVKNNYHSEAFSVNFADSEEAKKVINDYVEKGTQGKIVDLMKQLDEDTVFALVNYIFFKGKWKRPFNPEHTRDADFHVDKSTTVKVPMMNRLGMFDMHYCSTLSSWVLMMDYLGNATAIFLLPDDGKMQHLEQTLTKDLISRFLLNRQTRSAILYFPKLSISGTYNLKTLLSSLGITRVFNNDADLSGITEDAPLKLSQAVHKAVLTLDERGTEAAGATVVEAVPMSLPPQVKFDHPFIFMIVESETQSPLFVGKVIDPTR

Approximately 50-60 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.