SFRP1 Protein, Mouse (CHO, His)

SFRP1 Protein is a secreted glycoprotein member of the SFRP family.SFRP1 Protein can act as an inhibitor of Wnt signaling and is capable of resisting vascular cell proliferation.SFRP1 Protein, Mouse (CHO, His) is the recombinant mouse-derived SFRP1 protein, expressed by CHO , with C-10*His labeled tag.

SFRP1 protein is an inhibitor of Wnt signaling, which can inhibit WNT1/WNT4-mediated TCF-dependent transcription. SFRP1 protein can reduce intracellular beta-catenin levels.SFRP1 Protein has anti-proliferative effects on vascular cells in vitro and in vivo, and can induce angiogenesis in vivo. In the vascular cell cycle, SFRP1 Protein delays the G1 phase and enters the S phase. In kidney development, SFRP1 Protein inhibits the formation of posterior renal tubules and the growth of buds. SFRP1 Protein plays a key role in maintaining the function of hematopoietic stem cells (HSC). SFRP1 Protein is a multifunctional regulator of intercellular communication, and can be used as a potential target for treating chronic inflammation in neurodegenerative diseases^[1][2]

Measured by its ability to inhibit Topflash reporter activity in HEK293T human embryonic kidney cells. The ED₅₀ for this effect is typically 0.4-2 μg/mL in the presence of 300 ng/mL of Recombinant Mouse Wnt-3a.

Mouse

CHO

C-10*His

AAC53145.1 (S32-K314)

20377  [NCBI]

SEYDYVSFQSDIGSYQSGRFYTKPPQCVDIPVDLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHMGTQVFLCSLFAPVCLDRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNTTEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKELKALVLFLKNGADCPCHQLDNLSHNFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKRMKNHECPTFQSVFK

Approximately 32.6 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.