SFRP2 Protein, Mouse (HEK293, His)

SFRP2 protein has multiple functions such as Wnt protein binding and receptor ligand activity, and regulates gene expression and signal transduction.It functions upstream in animal organ development, signal transduction, and regulation of endopeptidase activity.SFRP2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived SFRP2 protein, expressed by HEK293 , with C-His labeled tag.

SFRP2 protein exhibits diverse functions, including Wnt-protein binding activity, endopeptidase activator activity, and receptor ligand activity. It plays a crucial role in regulating gene expression, protein phosphorylation, and signal transduction. Operating upstream of various processes such as animal organ development, negative regulation of signal transduction, and the regulation of endopeptidase activity, SFRP2 is located in the extracellular space. The expression of SFRP2 spans multiple structures, including the alimentary system, brain, embryo mesenchyme, eye, and genitourinary system. The biased expression in specific tissues, such as the limb at embryonic day 14.5 and the adult mammary gland, suggests its involvement in tissue-specific developmental and regulatory processes.

Measured by its ability to compete with Frizzled-1 for binding to biotinylated Wnt-3a. The IC₅₀ value is 1.48 nM, under conditions in which Recombinant Mouse (rm) Frizzled-1 is present at 2.1 nM, and biotinylated rmWnt-3a concentration is 2.7 nM.

• 
  Measured by its ability to compete with Frizzled-1 for binding to biotinylated Wnt-3a. The IC₅₀ value of SFRP2 is 1.48 nM, under conditions in which Recombinant Mouse (rm) Frizzled-1 is present at 2.1 nM, and biotinylated rmWnt-3a concentration is 2.7 nM.

Mouse

HEK293

C-His

NP_033170.1 (L25-C295)

20319  [NCBI]

LFLFGQPDFSYKRSNCKPIPANLQLCHGIEYQNMRLPNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKTKNEDDNDIMETLCKNDFALKIKVKEITYINRDTKIILETKSKTIYKLNGVSERDLKKSVLWLKDSLQCTCEEMNDINAPYLVMGQKQGGELVITSVKRWQKGQREFKRISRSIRKLQC

Approximately 31-36 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.