SFRP4 Protein, Mouse (HEK293, His)

SFRP4 Protein, a soluble frizzled-related protein, directly interacts with Wnts, modulating Wnt signaling. It regulates cell growth and differentiation, impacting bone morphogenesis. In the adult uterus, SFRP4 serves as a regulator, potentially increasing apoptosis during ovulation via FZ1/FZ4/WNT4 signaling modulation. Additionally, it exhibits phosphaturic effects by inhibiting sodium-dependent phosphate uptake specifically. SFRP4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived SFRP4 protein, expressed by HEK293 , with C-His labeled tag.

SFRP4 is a soluble frizzled-related protein that acts as a modulator of Wnt signaling by directly interacting with Wnts. It regulates cell growth and differentiation in specific cell types and plays a role in bone morphogenesis. Additionally, SFRP4 acts as a regulator of adult uterine morphology and function and may increase apoptosis during ovulation, potentially through modulation of FZ1/FZ4/WNT4 signaling. It also exhibits phosphaturic effects by specifically inhibiting sodium-dependent phosphate uptake.

Mouse

HEK293

C-6*His

Q9Z1N6/NP_057896.1 (V19-S351)

20379  [NCBI]

VRGAPCEAVRIPMCRHMPWNITRMPNHLHHSTQENAILAIEQYEELVDVNCSSVLRFFLCAMYAPICTLEFLHDPIKPCKSVCQRARDDCEPLMKMYNHSWPESLACDELPVYDRGVCISPEAIVTDLPEDVKWIDITPDMMVQERSFDADCKRLSPDRCKCKKVKPTLATYLSKNYSYVIHAKIKAVQRSGCNEVTTVVDVKEIFKSLSPIPRTQVPLITNSSCQCPHILPHQDVLIMCYEWRSRMMLLENCLVEKWRDQLSRRSIQWEERLQEQQRTIQDKKQIASRTSRTSRSNPPKSKGRPPAPKPASPKKNIKARSAPKKSNLKKSAS

Approximately 55-70 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.