1. Recombinant Proteins
  2. Receptor Proteins
  3. SIGIRR Protein, Human (HEK293, His)

SIGIRR Protein, Human (HEK293, His)

Cat. No.: HY-P76065
COA Handling Instructions

SIGIRR proteins function as negative regulators of Toll-like and IL-1R receptor signaling pathways. It inhibits the recruitment of signaling components to the TLR4 receptor through TIR domain interactions. SIGIRR Protein, Human (HEK293, His) is the recombinant human-derived SIGIRR protein, expressed by HEK293 , with C-His labeled tag. The total length of SIGIRR Protein, Human (HEK293, His) is 118 a.a., with molecular weight of ~22-35 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
50 μg $170 In-stock
100 μg $290 In-stock
500 μg $930 In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

SIGIRR Protein, Human (HEK293, His) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SIGIRR proteins function as negative regulators of Toll-like and IL-1R receptor signaling pathways. It inhibits the recruitment of signaling components to the TLR4 receptor through TIR domain interactions. SIGIRR Protein, Human (HEK293, His) is the recombinant human-derived SIGIRR protein, expressed by HEK293 , with C-His labeled tag. The total length of SIGIRR Protein, Human (HEK293, His) is 118 a.a., with molecular weight of ~22-35 kDa.

Background

The SIGIRR protein acts as a negative regulator of the Toll-like and IL-1R receptor signaling pathways. It functions by inhibiting the recruitment of signaling components to the TLR4 receptor, likely through an interaction between their TIR domains. Furthermore, SIGIRR interferes with the heterodimerization of Il1R1 and IL1RAP through its extracellular domain. It interacts with various proteins including IL1R1, IRAK1, TLR4, TLR5, TLR9, TRAF6, and PALM3. Upon IL-1 stimulation, SIGIRR can be found in a complex consisting of IL1R1, SIGIRR, MYD88, IRAK1, and TRAF6. Similarly, upon stimulation with LPC, SIGIRR is present in a complex comprising TLR4, SIGIRR, MYD88, IRAK1, and TRAF6.

Species

Human

Source

HEK293

Tag

C-His

Accession

Q6IA17 (M1-H118)

Gene ID
Molecular Construction
N-term
SIGIRR (M1-H118)
Accession # Q6IA17
His
C-term
Synonyms
Single Ig IL-1-related receptor; Toll/interleukin-1 receptor 8; TIR8
AA Sequence

MPGVCDRAPDFLSPSEDQVLRPALGSSVALNCTAWVVSGPHCSLPSVQWLKDGLPLGIGGHYSLHEYSWVKANLSEVLVSSVLGVNVTSTEVYGAFTCSIQNISFSSFTLQRAGPTSH

Molecular Weight

The protein migrates as approximately 22-35 kDa under reducing SDS-PAGE due to glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

SIGIRR Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SIGIRR Protein, Human (HEK293, His)
Cat. No.:
HY-P76065
Quantity:
MCE Japan Authorized Agent: