Siglec-6 Protein, Human (HEK293, Fc)

Siglec-6 Protein, a putative adhesion molecule, facilitates sialic acid-dependent binding to cells, specifically binding to alpha-2,6-linked sialic acid. Its sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. Siglec-6 interacts with LEP. Siglec-6 Protein, Human (HEK293, Fc) is the recombinant human-derived Siglec-6 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Siglec-6 Protein, Human (HEK293, Fc) is 305 a.a., with molecular weight of 70-90 kDa.

The Siglec-6 Protein is a putative adhesion molecule that functions by mediating sialic acid-dependent binding to cells, specifically binding to alpha-2,6-linked sialic acid. Notably, the sialic acid recognition site of Siglec-6 may be masked by cis interactions with sialic acids on the same cell surface, suggesting a dynamic regulation of its binding properties. In addition to its adhesion role, Siglec-6 interacts with LEP, implying its involvement in cellular interactions and signaling processes. The multifaceted nature of Siglec-6 underscores its potential as a key player in sialic acid-mediated cellular adhesion and communication pathways.

Human

HEK293

C-hFc

O43699-3 (E27-V331)

946  [NCBI]

ERRFQLEGPESLTVQEGLCVLVPCRLPTTLPASYYGYGYWFLEGADVPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRLKSKWMKYGYTSSKLSVRVMALTHRPNISIPGTLESGHPSNLTCSVPWVCEQGTPPIFSWMSAAPTSLGPRTTQSSVLTITPRPQDHSTNLTCQVTFPGAGVTMERTIQLNVSSFKILQNTSSLPVLEGQALRLLCDADGNPPAHLSWFQGFPALNATPISNTGVLELPQVGSAEEGDFTCRAQHPLGSLQISLSLFVHWKPEGRAGGV

70-90 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.5.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.