1. Recombinant Proteins
  2. Receptor Proteins
  3. Siglec
  4. Siglec-6 Protein, Human (HEK293, Fc)

Siglec-6 Protein, a putative adhesion molecule, facilitates sialic acid-dependent binding to cells, specifically binding to alpha-2,6-linked sialic acid. Its sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. Siglec-6 interacts with LEP. Siglec-6 Protein, Human (HEK293, Fc) is the recombinant human-derived Siglec-6 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Siglec-6 Protein, Human (HEK293, Fc) is 305 a.a., with molecular weight of 70-90 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Siglec-6 Protein, a putative adhesion molecule, facilitates sialic acid-dependent binding to cells, specifically binding to alpha-2,6-linked sialic acid. Its sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. Siglec-6 interacts with LEP. Siglec-6 Protein, Human (HEK293, Fc) is the recombinant human-derived Siglec-6 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Siglec-6 Protein, Human (HEK293, Fc) is 305 a.a., with molecular weight of 70-90 kDa.

Background

The Siglec-6 Protein is a putative adhesion molecule that functions by mediating sialic acid-dependent binding to cells, specifically binding to alpha-2,6-linked sialic acid. Notably, the sialic acid recognition site of Siglec-6 may be masked by cis interactions with sialic acids on the same cell surface, suggesting a dynamic regulation of its binding properties. In addition to its adhesion role, Siglec-6 interacts with LEP, implying its involvement in cellular interactions and signaling processes. The multifaceted nature of Siglec-6 underscores its potential as a key player in sialic acid-mediated cellular adhesion and communication pathways.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

O43699-3 (E27-V331)

Gene ID

946  [NCBI]

Molecular Construction
N-term
Siglec-6 (E27-V331)
Accession # O43699-3
hFc
C-term
Synonyms
CD327; CD33 antigen-like 1; CD33L1; CDw327; OB-BP1; Siglec6; Siglec-6
AA Sequence

ERRFQLEGPESLTVQEGLCVLVPCRLPTTLPASYYGYGYWFLEGADVPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRLKSKWMKYGYTSSKLSVRVMALTHRPNISIPGTLESGHPSNLTCSVPWVCEQGTPPIFSWMSAAPTSLGPRTTQSSVLTITPRPQDHSTNLTCQVTFPGAGVTMERTIQLNVSSFKILQNTSSLPVLEGQALRLLCDADGNPPAHLSWFQGFPALNATPISNTGVLELPQVGSAEEGDFTCRAQHPLGSLQISLSLFVHWKPEGRAGGV

Molecular Weight

70-90 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Siglec-6 Protein, Human (HEK293, Fc) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Siglec-6 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P71031
Quantity:
MCE Japan Authorized Agent: