SIRT5 Protein, Human (Flag)

SIRT5 Proteins, belonging to the sirtuin family, possess a sirtuin core domain and share homology with yeast Sir2 protein. They are classified in class III of the sirtuin family and undergo alternative splicing, resulting in multiple transcript variants. Their ubiquitous expression in tissues like the heart, liver, and 25 others suggests their involvement in diverse cellular processes. SIRT5 Protein, Human (Flag) is the recombinant human-derived SIRT5 protein, expressed by E. coli , with N-Flag labeled tag.

SIRT5, a member of the sirtuin family, shares homology with the yeast Sir2 protein and is characterized by a sirtuin core domain. The sirtuin family is divided into four classes, and while the specific functions of human sirtuins are yet to be fully elucidated, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that human sirtuins may serve as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. SIRT5, classified within class III of the sirtuin family, undergoes alternative splicing, resulting in multiple transcript variants. The expression of SIRT5 is ubiquitous, observed in various tissues, including the heart, liver, and 25 other tissues, highlighting its likely involvement in diverse cellular processes.

Measured by its ability to remove the succinyl group from 25 μM fluorogenic peptide substrate incubate at room temperature for 30 minutes. The specific activity is 181.22 pmol/min/μg.

Human

E. coli

N-Flag

NP_036373.1/Q9NXA8-1 (R2-S310)

23408  [NCBI]

RPLQIVPSRLISQLYCGLKPPASTRNQICLKMARPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALACHENETVS

Approximately 33-37 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, 1 mM DTT, pH 8.2 or 20 mM PB, 150 mM NaCl, 1 mM DTT, pH 7.8 or PBS, pH 7.8, 1mM DTT, 5% trehalose, 5% mannitol and 0.01% Tween80 or PBS, pH 7.8, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.