1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens Biotinylated Proteins
  3. Inhibitory Checkpoint Molecules Macrophage CD Proteins Monocyte CD Proteins
  4. NTB-A/CD352 NTB-A/CD352
  5. SLAMF6 Protein, Human (HEK293, His-Avi)

SLAMF6 Protein, Human (HEK293, His-Avi)

Cat. No.: HY-P72415
Handling Instructions

SLAMF6 protein is an autoligand receptor in the SLAM family, which is critical for the activation and differentiation of immune cells and coordinates innate and adaptive immune responses. SLAMF6 is regulated by cytoplasmic adapters such as SH2D1A/SAP and/or SH2D1B/EAT-2, and can trigger the cytolytic activity of NK cells, including VAV1 phosphorylation and SH2D1B dependence. SLAMF6 Protein, Human (HEK293, His-Avi) is the recombinant human-derived SLAMF6 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag. The total length of SLAMF6 Protein, Human (HEK293, His-Avi) is 204 a.a., with molecular weight of 35-50 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SLAMF6 protein is an autoligand receptor in the SLAM family, which is critical for the activation and differentiation of immune cells and coordinates innate and adaptive immune responses. SLAMF6 is regulated by cytoplasmic adapters such as SH2D1A/SAP and/or SH2D1B/EAT-2, and can trigger the cytolytic activity of NK cells, including VAV1 phosphorylation and SH2D1B dependence. SLAMF6 Protein, Human (HEK293, His-Avi) is the recombinant human-derived SLAMF6 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag. The total length of SLAMF6 Protein, Human (HEK293, His-Avi) is 204 a.a., with molecular weight of 35-50 kDa.

Background

SLAMF6, a self-ligand receptor within the signaling lymphocytic activation molecule (SLAM) family, plays a crucial role in modulating the activation and differentiation of diverse immune cells, contributing to the intricate regulation and coordination of both innate and adaptive immune responses. The activities of SLAMF6 are finely controlled by the presence or absence of small cytoplasmic adapter proteins, such as SH2D1A/SAP and/or SH2D1B/EAT-2. Notably, SLAMF6 triggers cytolytic activity specifically in natural killer (NK) cells expressing high surface densities of natural cytotoxicity receptors and engages positive signaling in NK cells, involving the phosphorylation of VAV1 and dependence on SH2D1B rather than SH2D1A. In conjunction with SLAMF1, SLAMF6 governs the transition and differentiation of the thymocytic natural killer T (NKT) cell lineage. Additionally, SLAMF6 promotes T-cell differentiation into a Th17 phenotype, leading to increased IL-17 secretion, and acts in concert with SLAMF1 and CD84/SLAMF5 as a potential negative regulator of the humoral immune response. Furthermore, in the absence of SH2D1A/SAP, SLAMF6 can transmit negative signals to CD4(+) T-cells and NKT cells, negatively regulating germinal center formation and potentially contributing to B-cell tolerance in germinal centers while preventing autoimmunity. SLAMF6 exists as a homodimer and interacts with PTN6 and PTN11, as well as with SH2D1A/SAP and SH2D1B/EAT2, with both adapter proteins able to associate with the same SLAMF6 molecule, mediated by ITSM 2.

Species

Human

Source

HEK293

Tag

C-Avi;C-6*His

Accession

Q96DU3-1 (Q22-K225)

Gene ID
Molecular Construction
N-term
SLAMF6 (Q22-K225)
Accession # Q96DU3-1
6*His-Avi
C-term
Synonyms
SLAM Family Member 6; Activating NK Receptor; NK-T-B-Antigen; NTB-A; CD352; SLAMF6; KALI
AA Sequence

QSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTK

Molecular Weight

35-50 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

SLAMF6 Protein, Human (HEK293, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SLAMF6 Protein, Human (HEK293, His-Avi)
Cat. No.:
HY-P72415
Quantity:
MCE Japan Authorized Agent: