1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Inhibitory Checkpoint Molecules Macrophage CD Proteins Monocyte CD Proteins
  4. NTB-A/CD352 NTB-A/CD352
  5. SLAMF6 Protein, Mouse (HEK293, His)

SLAMF6 protein is a self-ligand receptor in the SLAM family, which complexly regulates the activation and differentiation of immune cells through homotypic or heterotypic interactions, affecting innate and adaptive immune responses. It relies on cytoplasmic adapters such as SH2D1A/SAP and/or SH2D1B/EAT-2 for activity control. SLAMF6 Protein, Mouse (HEK293, His) is the recombinant mouse-derived SLAMF6 protein, expressed by HEK293 , with C-His labeled tag. The total length of SLAMF6 Protein, Mouse (HEK293, His) is 209 a.a., with molecular weight of ~28-50 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SLAMF6 protein is a self-ligand receptor in the SLAM family, which complexly regulates the activation and differentiation of immune cells through homotypic or heterotypic interactions, affecting innate and adaptive immune responses. It relies on cytoplasmic adapters such as SH2D1A/SAP and/or SH2D1B/EAT-2 for activity control. SLAMF6 Protein, Mouse (HEK293, His) is the recombinant mouse-derived SLAMF6 protein, expressed by HEK293 , with C-His labeled tag. The total length of SLAMF6 Protein, Mouse (HEK293, His) is 209 a.a., with molecular weight of ~28-50 kDa.

Background

The SLAMF6 protein functions as a self-ligand receptor within the signaling lymphocytic activation molecule (SLAM) family, participating in homo- or heterotypic cell-cell interactions that modulate the activation and differentiation of various immune cells, contributing to the regulation and coordination of both innate and adaptive immune responses. The activities of SLAMF6 are intricately controlled by the presence or absence of small cytoplasmic adapter proteins, including SH2D1A/SAP and/or SH2D1B/EAT-2. Specifically, in natural killer (NK) cells expressing high surface densities of natural cytotoxicity receptors, SLAMF6 triggers cytolytic activity and implicates positive signaling that involves the phosphorylation of VAV1. Furthermore, in conjunction with SLAMF1, SLAMF6 controls the transition between positive selection and the subsequent expansion and differentiation of the thymocytic natural killer T (NKT) cell lineage. The protein also promotes T cell differentiation into a helper T-cell Th17 phenotype, leading to increased IL-17 secretion, with its costimulatory activity requiring SH2D1A. Additionally, SLAMF6, in association with SLAMF1 and CD84/SLAMF5, may act as a negative regulator of the humoral immune response. In the absence of SH2D1A/SAP, SLAMF6 transmits negative signals to CD4(+) T-cells and NKT cells, negatively regulating germinal center formation by inhibiting T-cell:B-cell adhesion, likely involving increased association with PTPN6/SHP-1 via ITSMs. However, conflicting reports suggest its role in mediating T-cell adhesion, participating in stable T-cell:B-cell interactions, and maintaining B-cell tolerance in germinal centers to prevent autoimmunity. Furthermore, SLAMF6 is implicated in the regulation of autoimmunity, and isoform 3 may act as a suppressor of pathogenic T-cell proliferation. The protein forms homodimers and interacts with PTN6, PTN11, and SH2D1A/SAP upon phosphorylation.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized recombinant mouse SLAMF6 at 2 μg/mL (100 μL/well) can bind biotinylated Human SH2D1A. The ED50 for this effect is 24.13 ng/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized recombinant mouse SLAMF6 at 2 μg/mL (100 μL/well) can bind biotinylated Human SH2D1A .The ED50 for this effect is 24.13 ng/mL.
Species

Mouse

Source

HEK293

Tag

C-His

Accession

Q9ET39 (E31-N239)

Gene ID
Molecular Construction
N-term
SLAMF6 (E31-N239)
Accession # Q9ET39
His
C-term
Synonyms
SLAM Family Member 6; Activating NK Receptor; NK-T-B-Antigen; NTB-A; CD352; SLAMF6; KALI
AA Sequence

EVSQSSSDPQLMNGVLGESAVLPLKLPAGKIANIIIWNYEWEASQVTALVINLSNPESPQIMNTDVKKRLNITQSYSLQISNLTMADTGSYTAQITTKDSEVITFKYILRVFERLGNLETTNYTLLLENGTCQIHLACVLKNQSQTVSVEWQATGNISLGGPNVTIFWDPRNSGDQTYVCRAKNAVSNLSVSVSTQSLCKGVLTNPPWN

Molecular Weight

The protein migrates as an approximately 28-50 kDa band under reducing SDS-PAGE due to glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

SLAMF6 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SLAMF6 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P76076
Quantity:
MCE Japan Authorized Agent: