1. Recombinant Proteins
  2. Others
  3. SOST Protein, Rat (Myc, His)

SOST protein inhibits bone growth by suppressing Wnt signaling and interacting with LRP4 and LRP5. Its interactions with LRP4 and LRP5 play crucial roles in suppressing Wnt signaling. The involvement of SOST in interactions with LRP6 highlights its regulatory role in bone growth. SOST Protein, Rat (Myc, His) is the recombinant rat-derived SOST protein, expressed by E. coli , with N-His, C-Myc labeled tag. The total length of SOST Protein, Rat (Myc, His) is 185 a.a., with molecular weight of ~28.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SOST protein inhibits bone growth by suppressing Wnt signaling and interacting with LRP4 and LRP5. Its interactions with LRP4 and LRP5 play crucial roles in suppressing Wnt signaling. The involvement of SOST in interactions with LRP6 highlights its regulatory role in bone growth. SOST Protein, Rat (Myc, His) is the recombinant rat-derived SOST protein, expressed by E. coli , with N-His, C-Myc labeled tag. The total length of SOST Protein, Rat (Myc, His) is 185 a.a., with molecular weight of ~28.0 kDa.

Background

SOST protein serves as a negative regulator of bone growth by actively inhibiting Wnt signaling and bone formation. Its interaction with LRP4, facilitated through the extracellular domain, plays a crucial role in suppressing Wnt signaling. Additionally, SOST interacts with LRP5, specifically through the first two YWTD-EGF repeat domains, resulting in the inhibition of Wnt-mediated signaling. The involvement of SOST in interactions with LRP6 further underscores its regulatory role in the intricate network of molecular events that govern bone growth and development.

Species

Rat

Source

E. coli

Tag

N-His;C-Myc

Accession

Q99P67 (29F-213Y)

Gene ID
Molecular Construction
N-term
10*His
SOST (29F-213Y)
Accession # Q99P67
C-term
Synonyms
Sost; Sclerostin
AA Sequence

FKNDATEIIPGLREYPEPPQELENNQTMNRAENGGRPPHHPYDTKDVSEYSCRELHYTRFVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRVKWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRSRKVRLVASCKCKRLTRFHNQSELKDFGPETARPQKGRKPRPRARGAKANQAELENAY

Molecular Weight

Approximately 28.0 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

SOST Protein, Rat (Myc, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SOST Protein, Rat (Myc, His)
Cat. No.:
HY-P71623
Quantity:
MCE Japan Authorized Agent: