SOST Protein, Rat (Myc, His)

SOST protein inhibits bone growth by suppressing Wnt signaling and interacting with LRP4 and LRP5. Its interactions with LRP4 and LRP5 play crucial roles in suppressing Wnt signaling. The involvement of SOST in interactions with LRP6 highlights its regulatory role in bone growth. SOST Protein, Rat (Myc, His) is the recombinant rat-derived SOST protein, expressed by E. coli , with N-His, C-Myc labeled tag. The total length of SOST Protein, Rat (Myc, His) is 185 a.a., with molecular weight of ~28.0 kDa.

SOST protein serves as a negative regulator of bone growth by actively inhibiting Wnt signaling and bone formation. Its interaction with LRP4, facilitated through the extracellular domain, plays a crucial role in suppressing Wnt signaling. Additionally, SOST interacts with LRP5, specifically through the first two YWTD-EGF repeat domains, resulting in the inhibition of Wnt-mediated signaling. The involvement of SOST in interactions with LRP6 further underscores its regulatory role in the intricate network of molecular events that govern bone growth and development.

Rat

E. coli

N-His;C-Myc

Q99P67 (29F-213Y)

80722  [NCBI]

FKNDATEIIPGLREYPEPPQELENNQTMNRAENGGRPPHHPYDTKDVSEYSCRELHYTRFVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRVKWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRSRKVRLVASCKCKRLTRFHNQSELKDFGPETARPQKGRKPRPRARGAKANQAELENAY

Approximately 28.0 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.