1. Recombinant Proteins
  2. Others
  3. SP-10/ACRV1 Protein, Human (HEK293, C-His)

SP-10/ACRV1 Protein is a testis-specific acrosomal matrix protein, which is evolutionarily conserved among mammals. The gene coding for the SP-10 protein, Acrv1, served as an outstanding model to understand the regulation of male germ-cell-specific gene transcription. The human and mouse SP-10 proteins share homology in the carboxyl terminal region, but contain distinct amino termini. SP-10 probably has an important role in human sperm function, is a promising contraceptive vaccine immunogen for humans, and can serve as a marker protein. SP-10/ACRV1 Protein, Human (HEK293, C-His) is the recombinant human-derived SP-10/ACRV1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of SP-10/ACRV1 Protein, Human (HEK293, C-His) is 244 a.a., with molecular weight of ~35.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SP-10/ACRV1 Protein is a testis-specific acrosomal matrix protein, which is evolutionarily conserved among mammals. The gene coding for the SP-10 protein, Acrv1, served as an outstanding model to understand the regulation of male germ-cell-specific gene transcription. The human and mouse SP-10 proteins share homology in the carboxyl terminal region, but contain distinct amino termini. SP-10 probably has an important role in human sperm function, is a promising contraceptive vaccine immunogen for humans, and can serve as a marker protein[1][2]. SP-10/ACRV1 Protein, Human (HEK293, C-His) is the recombinant human-derived SP-10/ACRV1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of SP-10/ACRV1 Protein, Human (HEK293, C-His) is 244 a.a., with molecular weight of ~35.0 kDa.

Background

SP-10 is an abundant protein present in both the acrosomal matrix as well as in the inner acrosomal membrane. The SP-10 antibody has been shown to be useful for staging the seminiferous cycle in the mouse and human[1].
A full-length 45-kDa SP-10 precursor protein is present in the testis and that SP-10 peptides of 32, 30, 28, and 26 kDa result from proteolytic processing of the SP-10 precursor protein in the testis and/or alternative splicing[2].

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P26436-1 (Q22-I265)

Gene ID

56  [NCBI]

Molecular Construction
N-term
ACRV1 (Q22-I265)
Accession # P26436
6*His
C-term
Synonyms
Acrosomal Protein SP-10; Acrosomal Vesicle Protein 1; ACRV1
AA Sequence

QPNELSGSIDHQTSVQQLPGEFFSLENPSDAEALYETSSGLNTLSEHGSSEHGSSKHTVAEHTSGEHAESEHASGEPAATEHAEGEHTVGEQPSGEQPSGEHLSGEQPLSELESGEQPSDEQPSGEHGSGEQPSGEQASGEQPSGEHASGEQASGAPISSTSTGTILNCYTCAYMNDQGKCLRGEGTCITQNSQQCMLKKIFEGGKLQFMVQGCENMCPSMNLFSHGTRMQIICCRNQSFCNKI

Molecular Weight

Approximately 34-36 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

SP-10/ACRV1 Protein, Human (HEK293, C-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SP-10/ACRV1 Protein, Human (HEK293, C-His)
Cat. No.:
HY-P71139
Quantity:
MCE Japan Authorized Agent: