1. Recombinant Proteins
  2. Others
  3. SP-17 Protein, Human (His)

The SP-17 protein is an important sperm surface-binding protein that promotes high-affinity sperm attachment to the zona pellucida, indicating its critical role in fertilization. It is involved in the binding of the zona pellucida and carbohydrates, emphasizing its importance in the fertilization process. SP-17 Protein, Human (His) is the recombinant human-derived SP-17 protein, expressed by E. coli , with N-His labeled tag. The total length of SP-17 Protein, Human (His) is 151 a.a., with molecular weight of 20-28 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The SP-17 protein is an important sperm surface-binding protein that promotes high-affinity sperm attachment to the zona pellucida, indicating its critical role in fertilization. It is involved in the binding of the zona pellucida and carbohydrates, emphasizing its importance in the fertilization process. SP-17 Protein, Human (His) is the recombinant human-derived SP-17 protein, expressed by E. coli , with N-His labeled tag. The total length of SP-17 Protein, Human (His) is 151 a.a., with molecular weight of 20-28 kDa.

Background

SP-17 protein serves as a crucial sperm surface binding protein, facilitating the high-affinity attachment of spermatozoa to the zona pellucida. Its role suggests involvement in the binding of zona pellucida and carbohydrates, emphasizing its significance in the fertilization process. The protein exists in a homodimeric form and may potentially interact with ROPN1, contributing to the intricate molecular interactions essential for successful sperm-egg binding during fertilization.

Species

Human

Source

E. coli

Tag

N-His

Accession

Q15506 (M1-K151)

Gene ID
Molecular Construction
N-term
His
SP-17 (M1-K151)
Accession # Q15506
C-term
Synonyms
Sperm surface protein Sp17; CT22; Sp17-1; Sperm protein 17; SPA17;
AA Sequence

MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDPAEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEAKKMKTNSLQNEEKEENK

Molecular Weight

20-28 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20mM Tris, 150mM NaCL, pH 8.0. Normally 8% trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

SP-17 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SP-17 Protein, Human (His)
Cat. No.:
HY-P701069
Quantity:
MCE Japan Authorized Agent: