SP-17 Protein, Human (His)

The SP-17 protein is an important sperm surface-binding protein that promotes high-affinity sperm attachment to the zona pellucida, indicating its critical role in fertilization. It is involved in the binding of the zona pellucida and carbohydrates, emphasizing its importance in the fertilization process. SP-17 Protein, Human (His) is the recombinant human-derived SP-17 protein, expressed by E. coli , with N-His labeled tag. The total length of SP-17 Protein, Human (His) is 151 a.a., with molecular weight of 20-28 kDa.

SP-17 protein serves as a crucial sperm surface binding protein, facilitating the high-affinity attachment of spermatozoa to the zona pellucida. Its role suggests involvement in the binding of zona pellucida and carbohydrates, emphasizing its significance in the fertilization process. The protein exists in a homodimeric form and may potentially interact with ROPN1, contributing to the intricate molecular interactions essential for successful sperm-egg binding during fertilization.

Human

E. coli

N-His

Q15506 (M1-K151)

53340  [NCBI]

MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDPAEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEAKKMKTNSLQNEEKEENK

20-28 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20mM Tris, 150mM NaCL, pH 8.0. Normally 8% trehalose is added as protectant before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.