STC1/Stanniocalcin-1 Protein, Human (HEK293, His)

STC1/Stanniocalcin-1 Proteinas, a homodimer, crucially stimulates renal phosphate reabsorption, safeguarding against hypercalcemia. Disulfide linkages contribute to its structural integrity. Its role in renal processes underscores significance in regulating phosphate levels, emphasizing a key role in maintaining mineral homeostasis. STC1/Stanniocalcin-1 Protein, Human (HEK293, His) is the recombinant human-derived STC1/Stanniocalcin-1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of STC1/Stanniocalcin-1 Protein, Human (HEK293, His) is 230 a.a..

STC1, also known as Stanniocalcin-1 protein, plays a crucial role in stimulating renal phosphate reabsorption, thereby offering a potential safeguard against hypercalcemia. The protein functions as a homodimer, with disulfide linkages contributing to its structural integrity and functional activity. Its involvement in renal processes highlights its significance in the intricate regulation of phosphate levels, suggesting a key role in maintaining mineral homeostasis.

1.Measured in a cell proliferation assay using MCF-7 cells. The ED₅₀ for this effect is 1.019 ng/mL, corresponding to a specific activity is 9.81×10⁵ U/mg.
2.Measured by its ability to inhibit Wnt-3a-induced alkaline phosphatase production by MC3T3-E1 mouse preosteoblast cells. The ED₅₀ for this effect is 30.85 ng/mL in the presence of 10 ng/mL of Recombinant Mouse Wnt-3a. corresponding to a specific activity is 3.241×10⁴ units/mg.

• 
  Measured in a cell proliferation assay using MCF-7 cells. The ED₅₀ for this effect is 1.019 ng/mL, corresponding to a specific activity is 9.81×10⁵ U/mg.

Human

HEK293

C-6*His

P52823-1 (T18-A247)

6781  [NCBI]

THEAEQNDSVSPRKSRVAAQNSAEVVRCLNSALQVGCGAFACLENSTCDTDGMYDICKSFLYSAAKFDTQGKAFVKESLKCIANGVTSKVFLAIRRCSTFQRMIAEVQEECYSKLNVCSIAKRNPEAITEVVQLPNHFSNRYYNRLVRSLLECDEDTVSTIRDSLMEKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEEDSPSHIKRTSHESA

Approximately 30-40 kDa due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.