1. Recombinant Proteins
  2. Others
  3. STC1/Stanniocalcin-1 Protein, Human (HEK293, His)

STC1/Stanniocalcin-1 Protein, Human (HEK293, His)

Cat. No.: HY-P71338
Handling Instructions Technical Support

STC1/Stanniocalcin-1 Proteinas, a homodimer, crucially stimulates renal phosphate reabsorption, safeguarding against hypercalcemia. Disulfide linkages contribute to its structural integrity. Its role in renal processes underscores significance in regulating phosphate levels, emphasizing a key role in maintaining mineral homeostasis. STC1/Stanniocalcin-1 Protein, Human (HEK293, His) is the recombinant human-derived STC1/Stanniocalcin-1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of STC1/Stanniocalcin-1 Protein, Human (HEK293, His) is 230 a.a..

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample (5 μg)   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

STC1/Stanniocalcin-1 Proteinas, a homodimer, crucially stimulates renal phosphate reabsorption, safeguarding against hypercalcemia. Disulfide linkages contribute to its structural integrity. Its role in renal processes underscores significance in regulating phosphate levels, emphasizing a key role in maintaining mineral homeostasis. STC1/Stanniocalcin-1 Protein, Human (HEK293, His) is the recombinant human-derived STC1/Stanniocalcin-1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of STC1/Stanniocalcin-1 Protein, Human (HEK293, His) is 230 a.a..

Background

STC1, also known as Stanniocalcin-1 protein, plays a crucial role in stimulating renal phosphate reabsorption, thereby offering a potential safeguard against hypercalcemia. The protein functions as a homodimer, with disulfide linkages contributing to its structural integrity and functional activity. Its involvement in renal processes highlights its significance in the intricate regulation of phosphate levels, suggesting a key role in maintaining mineral homeostasis.

Biological Activity

1.Measured in a cell proliferation assay using MCF-7 cells. The ED50 for this effect is 1.019 ng/mL, corresponding to a specific activity is 9.81×105 U/mg.
2.Measured by its ability to inhibit Wnt-3a-induced alkaline phosphatase production by MC3T3-E1 mouse preosteoblast cells. The ED50 for this effect is 30.85 ng/mL in the presence of 10 ng/mL of Recombinant Mouse Wnt-3a. corresponding to a specific activity is 3.241×104 units/mg.

  • Measured in a cell proliferation assay using MCF-7 cells. The ED50 for this effect is 1.019 ng/mL, corresponding to a specific activity is 9.81×105 U/mg.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

P52823-1 (T18-A247)

Gene ID
Molecular Construction
N-term
STC1 (T18-A247)
Accession # P52823
6*His
C-term
Synonyms
Stanniocalcin 1; stanniocalcin-1; STC1; STC-1; STCSTC-1
AA Sequence

THEAEQNDSVSPRKSRVAAQNSAEVVRCLNSALQVGCGAFACLENSTCDTDGMYDICKSFLYSAAKFDTQGKAFVKESLKCIANGVTSKVFLAIRRCSTFQRMIAEVQEECYSKLNVCSIAKRNPEAITEVVQLPNHFSNRYYNRLVRSLLECDEDTVSTIRDSLMEKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEEDSPSHIKRTSHESA

Molecular Weight

Approximately 30-40 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

STC1/Stanniocalcin-1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
STC1/Stanniocalcin-1 Protein, Human (HEK293, His)
Cat. No.:
HY-P71338
Quantity:
MCE Japan Authorized Agent: