SULT1A3 Protein, Human (N-His)

SULT1A3 protein, a sulfotransferase utilizing PAPS, catalyzes the sulfate conjugation of phenolic monoamines, including neurotransmitters (dopamine, norepinephrine, serotonin) and drugs. This activity contributes significantly to inactivation and elimination, emphasizing SULT1A3's crucial role in regulating neurotransmitter and drug levels, maintaining homeostasis, and ensuring proper biological system functioning. SULT1A3 Protein, Human (N-His) is the recombinant human-derived SULT1A3, expressed by E. coli , with N-6*His labeled tag. ,

SULT1A3 protein, a sulfotransferase utilizing 3'-phospho-5'-adenylyl sulfate (PAPS) as its sulfonate donor, plays a pivotal role in catalyzing the sulfate conjugation of phenolic monoamines, including neurotransmitters such as dopamine, norepinephrine, and serotonin, as well as phenolic and catechol drugs. This enzymatic activity contributes significantly to the inactivation and elimination of these bioactive molecules, highlighting SULT1A3's crucial role in regulating the levels and activity of neurotransmitters and certain pharmacologically relevant compounds. The substrate specificity of SULT1A3 underscores its importance in modulating physiological responses to neurotransmitters and drugs, emphasizing its significance in maintaining homeostasis and proper functioning of biological systems.

Measured by its ability to transfer sulfate from PAPS to 1-Napthol. The specific activity is 855.567 pmol/min/μg that incubate at 37 ºC for 20 minutes.

Human

E. coli

N-6*His

P0DMM9-1 (M1-L295)

445329

MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL

Approximately 35 kDa.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose, 8% mannitol and 0.02% Tween80.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.