1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. SULT1C4 Protein, Human (His)

The SULT1C4 protein is an important member of the sulfotransferase 1 family and plays a crucial role in phase II drug metabolism and binding of endogenous compounds.Its research enhances the understanding of xenobiotic metabolism and has potential applications in pharmacology.SULT1C4 Protein, Human (His) is the recombinant human-derived SULT1C4 protein, expressed by E.coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The SULT1C4 protein is an important member of the sulfotransferase 1 family and plays a crucial role in phase II drug metabolism and binding of endogenous compounds.Its research enhances the understanding of xenobiotic metabolism and has potential applications in pharmacology.SULT1C4 Protein, Human (His) is the recombinant human-derived SULT1C4 protein, expressed by E.coli , with N-6*His labeled tag.

Background

The SULT1C4 Protein is a vital member of the sulfotransferase 1 family, underscoring its crucial role in phase II drug metabolism and the conjugation of various endogenous compounds. As part of this family, SULT1C4 likely shares conserved structural and functional features with related proteins, emphasizing its involvement in the transfer of sulfate groups to substrates. The classification within the sulfotransferase 1 family underscores its specific designation within the broader context of enzymes involved in sulfate conjugation, providing insights into its unique catalytic functions. The study of SULT1C4 contributes to our understanding of its role in cellular processes related to detoxification and the regulation of biological activities, offering potential applications in pharmacology and a deeper comprehension of its broader impact on xenobiotic metabolism. Further exploration of SULT1C4's role holds promise for enhancing our knowledge of its contributions to both normal physiology and responses to chemical exposure.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q6PD90 (M1-K102)

Gene ID
Molecular Construction
N-term
6*His
SULT1C4 (M1-K102)
Accession # Q6PD90
C-term
Synonyms
SULT1C4; Sulfotransferase; SULT1C2; hCG_27301; ;
AA Sequence

MALHDMEDFTFDGTKRLSVNYVKGILQPTDTCDIWDKIWNFQAKPDDLLISTYPKAGTTWTQEIVELIQNEGDVEKSKRAPTHQRFPFLEMKIPSLGSGEYK

Molecular Weight

Approximately 14.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 10 mM NaAc, pH 4.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

SULT1C4 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SULT1C4 Protein, Human (His)
Cat. No.:
HY-P71342
Quantity:
MCE Japan Authorized Agent: