SULT2A1 Protein, Human (His)

The SULT2A1 protein utilizes PAPS for critical sulfonation of steroids and bile acids in the liver and adrenal glands. Its multifunctional activity extends to a variety of compounds, enhancing its water solubility to facilitate renal excretion. SULT2A1 Protein, Human (His) is the recombinant human-derived SULT2A1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of SULT2A1 Protein, Human (His) is 284 a.a., with molecular weight of 34-38 kDa.

SULT2A1 protein, a sulfotransferase utilizing 3'-phospho-5'-adenylyl sulfate (PAPS) as its sulfonate donor, serves as a crucial mediator in the sulfonation of steroids and bile acids within the liver and adrenal glands. Demonstrating versatile enzymatic activity, SULT2A1 facilitates the sulfation of an extensive array of steroids and sterols, including pregnenolone, androsterone, DHEA, bile acids, cholesterol, and numerous xenobiotics featuring alcohol and phenol functional groups. This sulfonation process enhances the water solubility of these compounds, facilitating their renal excretion; however, it also has the potential to lead to bioactivation, forming active metabolites. SULT2A1's multifaceted roles extend to maintaining steroid and lipid homeostasis, playing a pivotal role in bile acid metabolism, and catalyzing the metabolic activation of potent carcinogenic polycyclic arylmethanols. The diverse substrate specificity of SULT2A1 underscores its significance in regulating essential physiological processes and its potential involvement in the metabolic activation of compounds with carcinogenic properties.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

N-6*His

Q06520 (S2-E285)

6822  [NCBI]

SDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE

34-38 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 100 mM NaCl, pH 8.0.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.