SUMO3 Protein, Human (HEK293, His)

SUMO3 is a multifunctional ubiquitin-like protein that can attach to target lysines, acting as a monomer or forming lysine-linked polymers. Unlike ubiquitin, SUMO3 is not involved in protein degradation; instead, it may counteract ubiquitin degradation. SUMO3 Protein, Human (HEK293, His) is the recombinant human-derived SUMO3 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of SUMO3 Protein, Human (HEK293, His) is 91 a.a., with molecular weight of ~21.0 kDa.

SUMO3, a ubiquitin-like protein, exhibits versatile functionality by being covalently attached to target lysines, either as a monomer or forming lysine-linked polymers. Unlike ubiquitin, SUMO3 does not seem to participate in protein degradation; instead, it potentially acts as an antagonist of ubiquitin in the degradation process. Its involvement spans various cellular processes, including nuclear transport, DNA replication and repair, mitosis, and signal transduction. The covalent attachment of SUMO3 to its substrates necessitates prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, with promotion facilitated by E3 ligases such as PIAS1-4, RANBP2, or CBX4. SUMO3 is implicated in the regulation of the sumoylation status of SETX and engages in interactions with various proteins, including BMAL1, USP25 (via its SIM domain), SAE2, and UBE2I. Notably, its interaction with USP25 leads to the sumoylation of USP25, inhibiting its ubiquitin hydrolyzing activity.

Human

HEK293

C-6*His

P55854 (S2-G92)

6612  [NCBI]

SEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG

Approximately 21.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM Citrate, 10% Trehalose, 3% Dextran-70, 50 mM NaCl, 0.05% Tween 80, pH 3.5.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.