1. Recombinant Proteins
  2. Others
  3. SUMO3 Protein, Human (HEK293, His)

SUMO3 is a multifunctional ubiquitin-like protein that can attach to target lysines, acting as a monomer or forming lysine-linked polymers. Unlike ubiquitin, SUMO3 is not involved in protein degradation; instead, it may counteract ubiquitin degradation. SUMO3 Protein, Human (HEK293, His) is the recombinant human-derived SUMO3 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of SUMO3 Protein, Human (HEK293, His) is 91 a.a., with molecular weight of ~21.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

SUMO3 is a multifunctional ubiquitin-like protein that can attach to target lysines, acting as a monomer or forming lysine-linked polymers. Unlike ubiquitin, SUMO3 is not involved in protein degradation; instead, it may counteract ubiquitin degradation. SUMO3 Protein, Human (HEK293, His) is the recombinant human-derived SUMO3 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of SUMO3 Protein, Human (HEK293, His) is 91 a.a., with molecular weight of ~21.0 kDa.

Background

SUMO3, a ubiquitin-like protein, exhibits versatile functionality by being covalently attached to target lysines, either as a monomer or forming lysine-linked polymers. Unlike ubiquitin, SUMO3 does not seem to participate in protein degradation; instead, it potentially acts as an antagonist of ubiquitin in the degradation process. Its involvement spans various cellular processes, including nuclear transport, DNA replication and repair, mitosis, and signal transduction. The covalent attachment of SUMO3 to its substrates necessitates prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, with promotion facilitated by E3 ligases such as PIAS1-4, RANBP2, or CBX4. SUMO3 is implicated in the regulation of the sumoylation status of SETX and engages in interactions with various proteins, including BMAL1, USP25 (via its SIM domain), SAE2, and UBE2I. Notably, its interaction with USP25 leads to the sumoylation of USP25, inhibiting its ubiquitin hydrolyzing activity.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P55854 (S2-G92)

Gene ID
Molecular Construction
N-term
SUMO3 (S2-G92)
Accession # P55854
6*His
C-term
Synonyms
Small ubiquitin-related modifier 3; SUMO-3; SMT3 homolog 1; SUMO-2; Ubiquitin-like protein SMT3A; Smt3A
AA Sequence

SEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG

Molecular Weight

Approximately 21.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Citrate, 10% Trehalose, 3% Dextran-70, 50 mM NaCl, 0.05% Tween 80, pH 3.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

SUMO3 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SUMO3 Protein, Human (HEK293, His)
Cat. No.:
HY-P71346
Quantity:
MCE Japan Authorized Agent: