1. Recombinant Proteins
  2. Others
  3. TAFA1/FAM19A1 Protein, Human

The Dll3 protein is a transmembrane ligand that plays a critical role in regulating cell differentiation and patterning during embryonic development. It participates in the Notch signaling pathway and helps determine cell fate. TAFA1/FAM19A1 Protein, Human is the recombinant human-derived TAFA1/FAM19A1 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The Dll3 protein is a transmembrane ligand that plays a critical role in regulating cell differentiation and patterning during embryonic development. It participates in the Notch signaling pathway and helps determine cell fate. TAFA1/FAM19A1 Protein, Human is the recombinant human-derived TAFA1/FAM19A1 protein, expressed by E. coli , with tag free.

Background

The TAFA1/FAM19A1 protein belongs to the TAFA family, which consists of five closely related genes encoding small secreted proteins. These proteins share conserved cysteine residues at specific positions and are distantly related to MIP-1alpha, a member of the CC-chemokine family. Primarily expressed in distinct brain regions, the TAFA proteins are believed to act as brain-specific chemokines or neurokines that regulate immune and nervous cells. This information is provided by RefSeq in July 2008. Notably, the TAFA1/FAM19A1 gene exhibits biased expression in the brain (RPKM 6.6) and prostate (RPKM 0.3).

Biological Activity

1.Measured by its ability to enhance neurite outgrowth of E16-E18 rat embryonic cortical neurons. Human TAFA1/FAM19A1, immobilized at 6-24 μg/mL on a 96-well plate, is able to significantly enhance neurite outgrowth.
2.Measured by its ability to enhance the outgrowth of SH-SY5Y cells. The ED50 for this effect is 2.756 μg/mL, corresponding to a specific activity is 362.845 units/mg.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q7Z5A9/NP_998774 (S26-T133)

Gene ID
Molecular Construction
N-term
TAFA1 (S26-T133)
Accession # Q7Z5A9/NP_998774
C-term
Synonyms
TAFA Chemokine Like Family Member 1; FAM19A1; TAFA-1; Family With Sequence Similarity 19 Member A1, C-C Motif Chemokine Like; Chemokine-Like Protein TAFA-1; Family With Sequence Similarity 19 (Chemokine (C-C Motif)-Like), Member A1; Protein FAM19A1; Famil
AA Sequence

SLQHTFQQHHLHRPEGGTCEVIAAHRCCNKNRIEERSQTVKCSCLPGKVAGTTRNRPSCVDASIVIGKWWCEMEPCLEGEECKTLPDNSGWMCATGNKIKTTRIHPRT

Molecular Weight

Approximately 12.4 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TAFA1/FAM19A1 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TAFA1/FAM19A1 Protein, Human
Cat. No.:
HY-P79169
Quantity:
MCE Japan Authorized Agent: