TAFA1/FAM19A1 Protein, Human

The Dll3 protein is a transmembrane ligand that plays a critical role in regulating cell differentiation and patterning during embryonic development. It participates in the Notch signaling pathway and helps determine cell fate. TAFA1/FAM19A1 Protein, Human is the recombinant human-derived TAFA1/FAM19A1 protein, expressed by E. coli , with tag free.

The TAFA1/FAM19A1 protein belongs to the TAFA family, which consists of five closely related genes encoding small secreted proteins. These proteins share conserved cysteine residues at specific positions and are distantly related to MIP-1alpha, a member of the CC-chemokine family. Primarily expressed in distinct brain regions, the TAFA proteins are believed to act as brain-specific chemokines or neurokines that regulate immune and nervous cells. This information is provided by RefSeq in July 2008. Notably, the TAFA1/FAM19A1 gene exhibits biased expression in the brain (RPKM 6.6) and prostate (RPKM 0.3).

1.Measured by its ability to enhance neurite outgrowth of E16-E18 rat embryonic cortical neurons. Human TAFA1/FAM19A1, immobilized at 6-24 μg/mL on a 96-well plate, is able to significantly enhance neurite outgrowth.
2.Measured by its ability to enhance the outgrowth of SH-SY5Y cells. The ED50 for this effect is 2.756 μg/mL, corresponding to a specific activity is 362.845 units/mg.

Human

E. coli

Tag Free

Q7Z5A9/NP_998774 (S26-T133)

407738  [NCBI]

SLQHTFQQHHLHRPEGGTCEVIAAHRCCNKNRIEERSQTVKCSCLPGKVAGTTRNRPSCVDASIVIGKWWCEMEPCLEGEECKTLPDNSGWMCATGNKIKTTRIHPRT

Approximately 12.4 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 200 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.