TARC/CCL17 Protein, Human (HEK293, His)

TARC/CCL17 Protein, Human (HEK293, His) is the first CC chemokine identified to interact with T cells with high affinity and bind to the CCR4 receptor to mediate inflammation, cancer, and autoimmune related diseases. TARC/CCL17 Protein, Human (HEK293, His) is a recombinant human TARC/CCL17(A24-S94) protein expressed by HEK293 with a his tag at C end^[1][2].

CCL17, also known as thymic and activating regulatory chemokine (TARC), is a powerful chemokine commonly associated with type 2 immune responses, and its encoding gene is located on chromosome 16 in humans. CCL17 can be produced by thymic and antigen-presenting cells such as dendritic cells, macrophages, and monocytes, and acts by binding to the cell surface chemokine receptor CCR4. CCR4 is a G protein-coupled receptor expressed as a chemokine receptor on Th2 cells, cutaneous lymphocytes skin-localized T cells and regulatory T cells, and also on T cells in adult T-cell leukemia/lymphoma and cutaneous T-cell lymphoma. CCR4 has an important role in the regulation of immune homeostasis and activation of innate immune cells in the central nervous system (CNS). CCL17 plays an important role in the recruitment of CCR4-positive Th2 lymphocytes, is involved in the transport of Th2 cells in eosinophil-associated diseases (including AA and AD) and may be involved in the transport of tumor cells in certain T-cell lymphomas.CCL17 is also thought to be a homeostatic and inducible neuromodulatory chemokine that maintains the typical highly branching morphology of hippocampal microglia under homeostatic conditions and promotes adaptation of microglia morphology to acute LPS-induced neuroinflammation. CCL17 is also associated with autoimmune and allergic disorders^[1][2].

CCL17 (0-1 ng/mL) can significantly induce CD⁴⁺ CD²⁵⁺ cell migration, but not CD⁴⁺ CD^25-cell migration in a dose-dependent manner in the cells purified from regional lymph nodes of gastric cancer patients^[3].
CCL17 (10-1,000 ng/mL, 12-48 h) can induce cell migration in human epithelial colon adenocarcinoma cell line HT-29 and is dependent on CCR4-mediated RhoA/Rho-kinase signaling, and CCL17-induced cell migration can be inhibited by preincubation with antibodies against CCR4 or antagonists against CCR4^[4].

Measured by its ability to chemoattract Jurkat human lymphoma cells. The ED₅₀ for this effect is 5.437 ng/mL, corresponding to a specific activity is 1.839×10⁵ U/mg.

• 
  Measured by its ability to chemoattract Jurkat human lymphoma cells. The ED₅₀ for this effect is 5.437 ng/mL, corresponding to a specific activity is 1.839×10⁵ U/mg.

Human

HEK293

C-6*His

Q92583 (A24-S94)

6361  [NCBI]

ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERSHHHHHH

Approximately 10-13 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against 20 mM Tris,150 mM NaCl, pH 8.0 or 20 mM His-HCl,10% Trehalose, 5% Maltose, 100 mM NaCl, 0.1% Tween 80, pH 6.5.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Julien Catherine, et al. What does elevated TARC/CCL17 expression tell us about eosinophilic disorders? Semin Immunopathol. 2021 Jun;43(3):439-458.  [Content Brief]

  [2]. Stefanie Scheu, et al. The C-C Chemokines CCL17 and CCL22 and Their Receptor CCR4 in CNS Autoimmunity. Int J Mol Sci. 2017 Nov 2;18(11):2306.  [Content Brief]

  [3]. Jan Korbecki, et al. CC Chemokines in a Tumor: A Review of Pro-Cancer and Anti-Cancer Properties of the Ligands of Receptors CCR1, CCR2, CCR3, and CCR4. Int J Mol Sci. 2020 Nov 9;21(21):8412.  [Content Brief]

  [4]. Kashif Rasheed, et al. CCL17/TARC and CCR4 expression in Merkel cell carcinoma. Oncotarget. 2018 Jul 31;9(59):31432-31447.  [Content Brief]

  [5]. Yoshiki Mizukami, et al. CCL17 and CCL22 chemokines within tumor microenvironment are related to accumulation of Foxp3+ regulatory T cells in gastric cancer. Int J Cancer. 2008 May 15;122(10):2286-93.  [Content Brief]

  [6]. Amr A Al-haidari, et al. CCR4 mediates CCL17 (TARC)-induced migration of human colon cancer cells via RhoA/Rho-kinase signaling. Int J Colorectal Dis. 2013 Nov;28(11):1479-87.  [Content Brief]