1. Recombinant Proteins
  2. CD Antigens
  3. Dendritic Cell CD Proteins
  4. 8D6A/CD320
  5. TCblR/CD320 Protein, Human (HEK293, His)

TCblR/CD320 is the receptor for cobalamin (TCbl) and is critical for cellular cobalamin homeostasis and B cell responses. It is expressed on follicular dendritic cells, interacts with germinal center B cells, and coordinates immune responses. TCblR/CD320 Protein, Human (HEK293, His) is the recombinant human-derived TCblR/CD320 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

TCblR/CD320 Protein, Human (HEK293, His) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TCblR/CD320 is the receptor for cobalamin (TCbl) and is critical for cellular cobalamin homeostasis and B cell responses. It is expressed on follicular dendritic cells, interacts with germinal center B cells, and coordinates immune responses. TCblR/CD320 Protein, Human (HEK293, His) is the recombinant human-derived TCblR/CD320 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

TCblR/CD320, a receptor for transcobalamin saturated with cobalamin (TCbl), is a crucial player in cobalamin uptake, emphasizing its significance in cellular cobalamin homeostasis. This plasma membrane protein is prominently expressed on follicular dendritic cells (FDC), where it facilitates interaction with germinal center B cells, contributing to the orchestration of immune responses. Beyond its role in cobalamin transport, TCblR/CD320 functions as a costimulator, promoting B cell responses to antigenic stimuli. This involvement includes the enhancement of B cell differentiation and proliferation, particularly within germinal center-B cells. The intricate interplay of TCblR/CD320 with germinal center B cells, T cells, and follicular dendritic cells is crucial for the differentiation of memory B cells and plasma cells, underscoring its multifaceted role in immune regulation. Moreover, TCblR/CD320's interaction with TCN2 further elucidates its involvement in cobalamin-related processes, contributing to our understanding of its diverse cellular functions.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q9NPF0-1 (S36-V231)

Gene ID
Molecular Construction
N-term
CD320 (S36-V231)
Accession # Q9NPF0-1
6*His
C-term
Synonyms
CD320 antigen; 8D6 antigen; FDC-signaling molecule 8D6; FDC-SM-8D6; Transcobalamin receptor; TCblR; CD320
AA Sequence

SPLSTPTSAQAAGPSSGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAYGV

Molecular Weight

37-57 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 10 mM Tris-Citrate,150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TCblR/CD320 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TCblR/CD320 Protein, Human (HEK293, His)
Cat. No.:
HY-P72456
Quantity:
MCE Japan Authorized Agent: