TCblR/CD320 Protein, Human (HEK293, His)

TCblR/CD320 is the receptor for cobalamin (TCbl) and is critical for cellular cobalamin homeostasis and B cell responses. It is expressed on follicular dendritic cells, interacts with germinal center B cells, and coordinates immune responses. TCblR/CD320 Protein, Human (HEK293, His) is the recombinant human-derived TCblR/CD320 protein, expressed by HEK293 , with C-6*His labeled tag.

TCblR/CD320, a receptor for transcobalamin saturated with cobalamin (TCbl), is a crucial player in cobalamin uptake, emphasizing its significance in cellular cobalamin homeostasis. This plasma membrane protein is prominently expressed on follicular dendritic cells (FDC), where it facilitates interaction with germinal center B cells, contributing to the orchestration of immune responses. Beyond its role in cobalamin transport, TCblR/CD320 functions as a costimulator, promoting B cell responses to antigenic stimuli. This involvement includes the enhancement of B cell differentiation and proliferation, particularly within germinal center-B cells. The intricate interplay of TCblR/CD320 with germinal center B cells, T cells, and follicular dendritic cells is crucial for the differentiation of memory B cells and plasma cells, underscoring its multifaceted role in immune regulation. Moreover, TCblR/CD320's interaction with TCN2 further elucidates its involvement in cobalamin-related processes, contributing to our understanding of its diverse cellular functions.

Human

HEK293

C-6*His

Q9NPF0-1 (S36-V231)

51293  [NCBI]

SPLSTPTSAQAAGPSSGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAYGV

37-53 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 10 mM Tris-Citrate,150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.