TDGF1 Protein, Human (HEK293, Fc)

The TDGF1 protein is a GPI-anchored cell membrane protein involved in Nodal signaling. TDGF1 Protein, Human (HEK293, Fc) is the recombinant human-derived TDGF1 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of TDGF1 Protein, Human (HEK293, Fc) is 139 a.a., with molecular weight of ~51.0 kDa.

The TDGF1 Protein, a GPI-anchored cell membrane protein, emerges as a key participant in Nodal signaling. Functioning as a Nodal coreceptor in cis, cell-associated CRIPTO, when shed by TMEM8A, dynamically modulates Nodal signaling by enabling soluble CRIPTO to serve as a Nodal coreceptor on neighboring cells. This shedding mechanism contributes to the intricate regulation of Nodal signaling pathways. Moreover, TDGF1 is implicated in the determination of epiblastic cells, which subsequently give rise to the mesoderm, underlining its significance in early developmental processes. Notably, TDGF1 interacts with the activin type-1 receptor ACVR1B, further underscoring its role in mediating critical cellular signaling events.

Measured by its binding ability in a functional ELISA. Immobilized Human ALK-4 at 2 μg/mL (100 μL/well) can bind biotinylated TDGF1. The ED₅₀ for this effect is 0.0939 μg/mL.

Human

HEK293

C-hFc

P13385 (L31-S169)

6997  [NCBI]

LGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPELPPS

Approximately 51.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.