1. Recombinant Proteins
  2. Others
  3. TEAD3 Protein, Human (His-SUMO)

TEAD3 protein is a transcription factor that plays a key role in the Hippo signaling pathway and is essential for organ size control and tumor suppression. It coordinates proliferation inhibition and apoptosis promotion through a kinase cascade involving MST1/MST2, SAV1, LATS1/2, and MOB1. TEAD3 Protein, Human (His-SUMO) is the recombinant human-derived TEAD3 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag. The total length of TEAD3 Protein, Human (His-SUMO) is 324 a.a., with molecular weight of ~52.3 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TEAD3 protein is a transcription factor that plays a key role in the Hippo signaling pathway and is essential for organ size control and tumor suppression. It coordinates proliferation inhibition and apoptosis promotion through a kinase cascade involving MST1/MST2, SAV1, LATS1/2, and MOB1. TEAD3 Protein, Human (His-SUMO) is the recombinant human-derived TEAD3 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag. The total length of TEAD3 Protein, Human (His-SUMO) is 324 a.a., with molecular weight of ~52.3 kDa.

Background

TEAD3, a transcription factor, assumes a pivotal role in the Hippo signaling pathway, a regulatory network crucial for organ size control and tumor suppression by orchestrating proliferation inhibition and apoptosis promotion. The core of this pathway involves a kinase cascade wherein MST1/MST2, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 complexed with its regulatory partner MOB1. MOB1 subsequently phosphorylates and inactivates the YAP1 oncoprotein and WWTR1/TAZ. TEAD3 functions by mediating the gene expression of YAP1 and WWTR1/TAZ, thereby regulating cell proliferation, migration, and epithelial-mesenchymal transition (EMT) induction. Additionally, TEAD3 is involved in binding to multiple functional elements of the human chorionic somatomammotropin-B gene enhancer. Its interactions with YAP1 and WWTR1/TAZ underscore its central role in the regulatory dynamics of this signaling pathway.

Species

Human

Source

E. coli

Tag

N-SUMO;N-6*His

Accession

Q99594 (M112-D435)

Gene ID
Molecular Construction
N-term
6*His-SUMO
TEAD3 (M112-D435)
Accession # Q99594
C-term
Synonyms
DTEF 1; DTEF-1; DTEF1; ETFR 1; ETFR1; TEA domain family member 3; TEA domain family member 5; TEAD 3; TEAD-3; Tead3; TEAD5; TEF 5; TEF5; Transcriptional enhancer factor 5
AA Sequence

MNLDQVSKDKALQSMASMSSAQIVSASVLQNKFSPPSPLPQAVFSTSSRFWSSPPLLGQQPGPSQDIKPFAQPAYPIQPPLPPTLSSYEPLAPLPSAAASVPVWQDRTIASSRLRLLEYSAFMEVQRDPDTYSKHLFVHIGQTNPAFSDPPLEAVDVRQIYDKFPEKKGGLKELYEKGPPNAFFLVKFWADLNSTIQEGPGAFYGVSSQYSSADSMTISVSTKVCSFGKQVVEKVETEYARLENGRFVYRIHRSPMCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTSRDSQETLLVIAFVFEVSTSEHGAQHHVYKLVKD

Molecular Weight

Approximately 52.3 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against solution in 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TEAD3 Protein, Human (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TEAD3 Protein, Human (His-SUMO)
Cat. No.:
HY-P71626
Quantity:
MCE Japan Authorized Agent: