1. Recombinant Proteins
  2. Others
  3. Tenascin/Tnc protein, Mouse (His-Myc)

Tenascin/Tnc proteins guide neuronal and axonal migration and contribute to development, synaptic plasticity, and neuronal regeneration.Tenascin/Tnc protein, Mouse (His-Myc) is the recombinant mouse-derived Tenascin/Tnc protein, expressed by HEK293 , with N-10*His, C-Myc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Tenascin/Tnc proteins guide neuronal and axonal migration and contribute to development, synaptic plasticity, and neuronal regeneration.Tenascin/Tnc protein, Mouse (His-Myc) is the recombinant mouse-derived Tenascin/Tnc protein, expressed by HEK293 , with N-10*His, C-Myc labeled tag.

Background

The Tenascin/Tnc protein, an extracellular matrix protein, assumes a critical role in guiding migrating neurons and axons during development, as well as contributing to synaptic plasticity and neuronal regeneration. It not only promotes neurite outgrowth in cultured neurons but also may play a role in supporting the growth of epithelial tumors, underscoring its diverse functional implications. Serving as a ligand for integrins ITGA8:ITGB1, ITGA9:ITGB1, ITGAV:ITGB3, and ITGAV:ITGB6, Tenascin/Tnc establishes molecular interactions essential for cellular communication and signaling. In the context of tumors, it stimulates angiogenesis by facilitating the elongation, migration, and sprouting of endothelial cells. Structurally, Tenascin/Tnc exists as a homohexamer with a potential homotrimer formation in the triple coiled-coil region, further stabilized by disulfide rings at both ends. The interaction with CSPG4 suggests its involvement in intricate cellular and molecular processes across diverse biological contexts.

Biological Activity

Measured by the ability of the immobilized protein to block Fibronectin-mediated adhesion of NIH-3T3 mouse embryonic fibroblast cells. Tenascin immobilized at 0.8 μg/mL, in the presence of 0.1 μg/mL human Fibronectin, will block approximately 55.14% NIH-3T3 cell adhesion (5×104 cells/well, 100 μL/well).

Species

Mouse

Source

HEK293

Tag

N-10*His;C-Myc

Accession

Q80YX1 (G1884-N2099)

Gene ID
Molecular Construction
N-term
10*His
Tenascin (G1884-N2099)
Accession # Q80YX1
Myc
C-term
Synonyms
Tenascin; TN; Hexabrachion; Tenascin-C (TN-C)
AA Sequence

GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN

Molecular Weight

27-31 kDa

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm sterile filtered 10 mM Tris-HCl,1 mM EDTA, 6% Trehalose, pH 8.0 or 50 mM Tris-HCL, 300 mM NaCL, pH 7.4,10% Glycerol or PBS, 6% Trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Tenascin/Tnc protein, Mouse (His-Myc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Tenascin/Tnc protein, Mouse (His-Myc)
Cat. No.:
HY-P700002
Quantity:
MCE Japan Authorized Agent: