TFF2 Protein, Human (His)

TFF2 Protein, a pivotal regulator in the gastrointestinal tract, inhibits gastrointestinal motility and gastric acid secretion. Its potential role as a structural component in gastric mucus is indicated, suggesting contributions to glycoprotein stabilization through interactions with carbohydrate side chains. This multifunctional role underscores TFF2's importance in preserving the integrity and homeostasis of the gastric environment. TFF2 Protein, Human (His) is the recombinant human-derived TFF2 protein, expressed by E. coli , with N-6*His labeled tag. The total length of TFF2 Protein, Human (His) is 106 a.a., with molecular weight of ~14 kDa.

TFF2 protein plays a regulatory role in the gastrointestinal tract by inhibiting both gastrointestinal motility and gastric acid secretion. Its potential involvement as a structural component in gastric mucus is suggested, wherein it might contribute to the stabilization of glycoproteins within the mucus gel through interactions with carbohydrate side chains. This multifaceted function positions TFF2 as a crucial player in maintaining the integrity and homeostasis of the gastric environment.

Measured by its ability to chemoattract bioassay using human MCF-7 cells. The ED₅₀ for this effect is 20.9 ng/mL, corresponding to a specific activity is 4.7846×10⁴ units/mg.

• 
  Measured by its ability to chemoattract bioassay using human MCF-7 cells. The ED₅₀ for this effect is 20.9 ng/mL, corresponding to a specific activity is 4.7846×10⁴ units/mg.

Human

E. coli

N-6*His

Q03403 (E24-Y129)

7032  [NCBI]

EKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY

Approximately 14 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, 200 mM arginine, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.