TFF2 Protein, Mouse (HEK293, His)

TFF2 Protein inhibits gastrointestinal motility and gastric acid secretion.It is proposed to act as a structural component of gastric mucus, potentially stabilizing glycoproteins within the mucus gel through interactions with carbohydrate side chains.This helps maintain the integrity of the gastric mucosal barrier.TFF2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TFF2 protein, expressed by HEK293 , with C-6*His labeled tag.

TFF2 (Trefoil Factor 2) functions as an inhibitor of gastrointestinal motility and gastric acid secretion. It is postulated to serve as a structural constituent of gastric mucus, potentially contributing to the stabilization of glycoproteins within the mucus gel through interactions with carbohydrate side chains, thereby playing a role in maintaining the integrity of the gastric mucosal barrier.

Mouse

HEK293

C-6*His

Q03404 (E24-Y129)

21785  [NCBI]

EKPSPCRCSRLTPHNRKNCGFPGITSEQCFDLGCCFDSSVAGVPWCFHPLPNQESEQCVMEVSARKNCGYPGISPEDCASRNCCFSNLIFEVPWCFFPQSVEDCHY

Approximately 14.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.