1. Recombinant Proteins
  2. Others
  3. TFPI Protein, Mouse (HEK293, C-His)

TFPI Protein, a potent inhibitor in the coagulation cascade, directly inhibits factor X (Xa). In a Xa-dependent manner, it also inhibits the activity of VIIa/tissue factor, potentially forming a quaternary complex with Xa, TFPI, VIIa, and tissue factor. Beyond its antithrombotic role, TFPI associates with plasma lipoproteins, indicating its regulatory involvement in hemostasis and clotting processes. TFPI Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived TFPI protein, expressed by HEK293 , with C-10*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg Get quote
50 μg Get quote
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TFPI Protein, a potent inhibitor in the coagulation cascade, directly inhibits factor X (Xa). In a Xa-dependent manner, it also inhibits the activity of VIIa/tissue factor, potentially forming a quaternary complex with Xa, TFPI, VIIa, and tissue factor. Beyond its antithrombotic role, TFPI associates with plasma lipoproteins, indicating its regulatory involvement in hemostasis and clotting processes. TFPI Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived TFPI protein, expressed by HEK293 , with C-10*His labeled tag.

Background

TFPI protein serves as a potent inhibitor in the coagulation cascade by directly inhibiting factor X (Xa). In a Xa-dependent manner, it further inhibits the activity of VIIa/tissue factor, potentially through the formation of a quaternary complex involving Xa, TFPI, VIIa, and tissue factor. Beyond its role in antithrombotic action, TFPI exhibits the capability to associate with lipoproteins in plasma, suggesting its involvement in regulating hemostasis and clotting processes.

Biological Activity

Measured by its ability to inhibit the proliferation of A549 human non-small cell lung cancer cells. The ED50 this effect is 36.62 ng/mL, corresponding to a specific activity is 3.731×104 units/mg.

Species

Mouse

Source

HEK293

Tag

C-10*His

Accession

O54819-1 (L29-K289)

Gene ID
Molecular Construction
N-term
TFPI (L29-K289)
Accession # O54819-1
10*His
C-term
Synonyms
Tissue factor pathway inhibitor; TFPI; EPI; LACI
AA Sequence

LSEEADDTDSELGSMKPLHTFCAMKADDGPCKAMIRSYFFNMYTHQCEEFIYGGCEGNENRFDTLEECKKTCIPGYEKTAVKAASGAERPDFCFLEEDPGLCRGYMKRYLYNNQTKQCERFVYGGCLGNRNNFETLDECKKICENPVHSPSPVNEVQMSDYVTDGNTVTDRSTVNNIVVPQSPKVPRRRDYRGRPWCLQPADSGLCKASERRFYYNSATGKCHRFNYTGCGGNNNNFTTRRRCLRSCKTGLIKNKSKGVVK

Molecular Weight

Approximately 42 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TFPI Protein, Mouse (HEK293, C-His) Related Classifications

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TFPI Protein, Mouse (HEK293, C-His)
Cat. No.:
HY-P73425A
Quantity:
MCE Japan Authorized Agent: