1. Recombinant Proteins
  2. Others
  3. TFPI Protein, Mouse (HEK293, C-His)

TFPI Protein, Mouse (HEK293, C-His)

Cat. No.: HY-P73425A
SDS COA Handling Instructions

TFPI Protein, a potent inhibitor in the coagulation cascade, directly inhibits factor X (Xa). In a Xa-dependent manner, it also inhibits the activity of VIIa/tissue factor, potentially forming a quaternary complex with Xa, TFPI, VIIa, and tissue factor. Beyond its antithrombotic role, TFPI associates with plasma lipoproteins, indicating its regulatory involvement in hemostasis and clotting processes. TFPI Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived TFPI protein, expressed by HEK293 , with C-10*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock
Free Sample   Apply now
5 μg Ask For Quote & Lead Time
10 μg Ask For Quote & Lead Time
50 μg Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TFPI Protein, a potent inhibitor in the coagulation cascade, directly inhibits factor X (Xa). In a Xa-dependent manner, it also inhibits the activity of VIIa/tissue factor, potentially forming a quaternary complex with Xa, TFPI, VIIa, and tissue factor. Beyond its antithrombotic role, TFPI associates with plasma lipoproteins, indicating its regulatory involvement in hemostasis and clotting processes. TFPI Protein, Mouse (HEK293, C-His) is the recombinant mouse-derived TFPI protein, expressed by HEK293 , with C-10*His labeled tag.

Background

TFPI protein serves as a potent inhibitor in the coagulation cascade by directly inhibiting factor X (Xa). In a Xa-dependent manner, it further inhibits the activity of VIIa/tissue factor, potentially through the formation of a quaternary complex involving Xa, TFPI, VIIa, and tissue factor. Beyond its role in antithrombotic action, TFPI exhibits the capability to associate with lipoproteins in plasma, suggesting its involvement in regulating hemostasis and clotting processes.

Species

Mouse

Source

HEK293

Tag

C-10*His

Accession

O54819-1 (L29-K289)

Gene ID
Molecular Construction
N-term
TFPI (L29-K289)
Accession # O54819-1
10*His
C-term
Synonyms
Tissue factor pathway inhibitor; TFPI; EPI; LACI
AA Sequence

LSEEADDTDSELGSMKPLHTFCAMKADDGPCKAMIRSYFFNMYTHQCEEFIYGGCEGNENRFDTLEECKKTCIPGYEKTAVKAASGAERPDFCFLEEDPGLCRGYMKRYLYNNQTKQCERFVYGGCLGNRNNFETLDECKKICENPVHSPSPVNEVQMSDYVTDGNTVTDRSTVNNIVVPQSPKVPRRRDYRGRPWCLQPADSGLCKASERRFYYNSATGKCHRFNYTGCGGNNNNFTTRRRCLRSCKTGLIKNKSKGVVK

Molecular Weight

Approximately 42 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

TFPI Protein, Mouse (HEK293, C-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TFPI Protein, Mouse (HEK293, C-His)
Cat. No.:
HY-P73425A
Quantity:
MCE Japan Authorized Agent: